KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0699Help
Entry
NMAA_0699         CDS       T01931                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK; 4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nmw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
811429..812274
Genome map
AA seq 281 aa AA seqDB search
MSVTDGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVDGMPQEADLSYRAASLLQKYARTPTGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQRQLIDSGAALGADVPFFIFGKNAFARGIGDRLDEMDIPKQWYVIVKPPVHVST
AKIFTHEGLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRNSAYNIYRQVSDLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttacggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccaagggacgacggcaaaatcatcctgcacaat
ccggttgatggaatgccgcaggaggcggatttaagctaccgtgccgcatcgttgctgcaa
aaatatgcacgcacccctaccggcgtggagatatggctggacaaaaaaattccgaccggg
gccggtttgggcggaggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgcggtctgacgcagcggcagctcattgattcgggcgcggctctgggggcggac
gtaccgttttttattttcggcaaaaatgcgtttgcgcggggtataggcgacaggctggac
gaaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccacc
gcaaaaattttcacacacgaaggcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaacctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgagttgtcccgatatggatttgccttaatgacaggttct
ggtgcgtgtgtattcacggcgtgtcaagataggaatagcgcatacaatatataccgacaa
gtttcagatttgtacgaggcatatttggcagagggtctttcaaaacatcctttgttgtcc
gtataa

DBGET integrated database retrieval system