KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0746Help
Entry
NMAA_0746         CDS       T01931                                 

Gene name
sdhD
Definition
succinate dehydrogenase membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMAA_0746 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMAA_0746 (sdhD)
   00650 Butanoate metabolism
    NMAA_0746 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMAA_0746 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863985..864326
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system