KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0746Help
Entry
NMAA_0746         CDS       T01931                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00020  Citrate cycle (TCA cycle)
nmw00190  Oxidative phosphorylation
nmw00650  Butanoate metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
nmw01130  Biosynthesis of antibiotics
nmw01200  Carbon metabolism
Module
nmw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMAA_0746 (sdhD)
   00650 Butanoate metabolism
    NMAA_0746 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMAA_0746 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CBY90624
Position
863985..864326
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system