KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0752Help
Entry
NMAA_0752         CDS       T01931                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMAA_0752 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMAA_0752 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMAA_0752 (sucB)
Enzymes [BR:nmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMAA_0752 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871699..872880
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAATAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgcatcgatacagctgct
actgccgctgctgaagcacctgcagccgctcctgccgaagcagccccggccgccgctcct
gccgccgcgcaaaacaacgccgctatgcctgccgccgccaaactggctgctgagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccactgctcctgctgttgcacttcctgcaggc
gcacgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgtctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaattg
ggctttatgtccttcttcgttaaagctgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgtggacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgcg
attggcagcccacgcggtttggttgtaccaatcctgcgtgatgccgaccaaatgagcatt
gccgacattgagcaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaacccacctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcatcgacggccgcgaagctgtattgactttggtagccattaaa
gacgcgttggaagacccagctcgcctgttgttggatctgtaa

DBGET integrated database retrieval system