KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0836Help
Entry
NMAA_0836         CDS       T01931                                 

Gene name
proB
Definition
glutamate 5-kinase (gamma-glutamyl kinase; GK) (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmw01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nmw00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965270..966379)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIATESGVPVYICSSLKPDA
LAEAADNQADGSFFVPRAKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKLRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacaccggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggctcgggttcggcaaacggcacaggcggtatgctgactaaaatcaaagcggcg
acgattgcgaccgagtccggcgtaccggtctatatctgttcctcgctcaaacccgatgca
cttgccgaagcggcagataatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagcaggggcggcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacagggaaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcctttgggcaaagggcgagtcctgttcggctctgccgccgccgaagacctgctc
aaattgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system