KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0836Help
Entry
NMAA_0836         CDS       T01931                                 

Gene name
proB
Definition
glutamate 5-kinase (gamma-glutamyl kinase; GK) (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMAA_0836 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMAA_0836 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMAA_0836 (proB)
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMAA_0836 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965270..966379)
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIATESGVPVYICSSLKPDA
LAEAADNQADGSFFVPRAKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKLRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacaccggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggctcgggttcggcaaacggcacaggcggtatgctgactaaaatcaaagcggcg
acgattgcgaccgagtccggcgtaccggtctatatctgttcctcgctcaaacccgatgca
cttgccgaagcggcagataatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagcaggggcggcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacagggaaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcctttgggcaaagggcgagtcctgttcggctctgccgccgccgaagacctgctc
aaattgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system