KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0950Help
Entry
NMAA_0950         CDS       T01931                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMAA_0950 (recR)
DNA repair and recombination proteins [BR:nmw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMAA_0950 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080593..1081213)
Genome map
AA seq 206 aa AA seqDB search
MMSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVDHC
ARCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggtttta
cccaacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgc
aaagaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtcgatcattgc
gcgaggtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcgacggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctgggcggcggagaagtcgaa
gaaatcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtcc
gagttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctg
attaaagaaggcggggcataa

DBGET integrated database retrieval system