KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0976Help
Entry
NMAA_0976         CDS       T01931                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMAA_0976 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMAA_0976 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMAA_0976 (thrC)
Enzymes [BR:nmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMAA_0976 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109158..1110624
Genome map
AA seq 488 aa AA seqDB search
MRQMPSEAVFLQFRQTRKIMKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRE
TLDKWRGLSYPELAFEIMRLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKI
QALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNV
FMLSPNGKMSAFQRAQMYSLQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVN
SINWGRIVAQVVYYFAGYFKATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVA
TNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWA
EVAAGKGFDLRFALEKVGGKYGFTSGKSTHPDRLATIRQVYEQDQELIDPHTADGVKVAR
EVREEGETVVCLETALAAKFDATIREAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVK
GIIEQTLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgccgtctgaagccgttttcctgcaatttcgacagacgagaaaaatcatg
aaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatg
gggcttgcccccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgcgaa
accttggacaaatggcgcggtttgtcttatcccgaattggcgtttgaaatcatgcgcctg
tttgttacggatattccggaagacgatttgcgcgacattctgaaccgtacttacacggaa
gcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatc
caagccttatccaacggccccactttggcattcaaagacatggcgatgcagtttttgggc
aatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcaacc
agcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaacgta
tttatgttgtcgcccaacggtaaaatgagcgcgttccaacgcgcgcaaatgtacagcctg
caagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggacatt
gtgaaggcggtgcaaaacgatgccgcgttcaaggaaaaataccatatcggtacggtcaat
tcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttcaaa
gcgacgcaaagcaatgacgagcaagtcagcttctgcgtgccgagcggcaacttcggcaac
gtttgcgcgggacacatcgccaaacagatgggtttgcctatccgccgcctgattgtcgcg
accaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgcaac
agcgcgcatacttatgttacctccagcccgtcgatggacatttccaaagcgtccaacttc
gagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgggcg
gaagtagcggcgggcaaaggctttgacctgcggtttgctttagaaaaagtcggtggcaaa
tacggttttacctccggcaaatccacccaccccgaccgcctcgccaccatcagacaggtt
tatgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcccgc
gaagtgcgcgaagaaggtgaaacggtggtttgtttggaaaccgcgttggcggcgaaattc
gatgcgaccatacgcgaagccgtcggcgatgtcgccattccgcgccctgccgcgctggaa
ggtttggaaaacctgccgcaacgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaa
ggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system