KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1249Help
Entry
NMAA_1249         CDS       T01931                                 

Definition
putative DNA polymerase III chi subunit (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nmw00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nmw00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:nmw03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nmw03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nmw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1474307..1474747)
Genome map
AA seq 146 aa AA seqDB search
MPKATFYTHVAQVPIFTCRLIARAIRDGGRILVWSDSFGRLQELDKMLWQYEAESFIPHE
IWEMEEAMPSETSVLLACGGNPPRIPEGMTVLNLSDGFWNTAPVLPARVLEIVGNSLEDL
ADARERFTAYRRSGFAIEHHGMEGKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccaccttttacacgcacgttgcccaagttccgattttcacctgccgcctg
attgcccgtgcgattcgggacggcggcaggatactggtgtggtccgattcgttcgggcgg
cttcaggaattggacaaaatgctttggcaatacgaagccgagagtttcattccgcacgaa
atttgggaaatggaagaagccatgccgtctgaaacatccgtcctgcttgcttgcggcggc
aatccgccccgaattcccgaaggcatgactgttttgaacctgtccgacggtttttggaac
accgctccggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcttggaagatctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcataa

DBGET integrated database retrieval system