KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1249Help
Entry
NMAA_1249         CDS       T01931                                 

Definition
putative DNA polymerase III chi subunit (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMAA_1249
   00240 Pyrimidine metabolism
    NMAA_1249
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NMAA_1249
   03430 Mismatch repair
    NMAA_1249
   03440 Homologous recombination
    NMAA_1249
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NMAA_1249
DNA replication proteins [BR:nmw03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NMAA_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1474307..1474747)
Genome map
AA seq 146 aa AA seqDB search
MPKATFYTHVAQVPIFTCRLIARAIRDGGRILVWSDSFGRLQELDKMLWQYEAESFIPHE
IWEMEEAMPSETSVLLACGGNPPRIPEGMTVLNLSDGFWNTAPVLPARVLEIVGNSLEDL
ADARERFTAYRRSGFAIEHHGMEGKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccaccttttacacgcacgttgcccaagttccgattttcacctgccgcctg
attgcccgtgcgattcgggacggcggcaggatactggtgtggtccgattcgttcgggcgg
cttcaggaattggacaaaatgctttggcaatacgaagccgagagtttcattccgcacgaa
atttgggaaatggaagaagccatgccgtctgaaacatccgtcctgcttgcttgcggcggc
aatccgccccgaattcccgaaggcatgactgttttgaacctgtccgacggtttttggaac
accgctccggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcttggaagatctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcataa

DBGET integrated database retrieval system