KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1249Help
Entry
NMAA_1249         CDS       T01931                                 

Definition
(GenBank) putative DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00230  Purine metabolism
nmw00240  Pyrimidine metabolism
nmw01100  Metabolic pathways
nmw03030  DNA replication
nmw03430  Mismatch repair
nmw03440  Homologous recombination
Module
nmw_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMAA_1249
   00240 Pyrimidine metabolism
    NMAA_1249
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NMAA_1249
   03430 Mismatch repair
    NMAA_1249
   03440 Homologous recombination
    NMAA_1249
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NMAA_1249
DNA replication proteins [BR:nmw03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NMAA_1249
DNA repair and recombination proteins [BR:nmw03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     NMAA_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CBY91170
Position
complement(1474307..1474747)
Genome map
AA seq 146 aa AA seqDB search
MPKATFYTHVAQVPIFTCRLIARAIRDGGRILVWSDSFGRLQELDKMLWQYEAESFIPHE
IWEMEEAMPSETSVLLACGGNPPRIPEGMTVLNLSDGFWNTAPVLPARVLEIVGNSLEDL
ADARERFTAYRRSGFAIEHHGMEGKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccaccttttacacgcacgttgcccaagttccgattttcacctgccgcctg
attgcccgtgcgattcgggacggcggcaggatactggtgtggtccgattcgttcgggcgg
cttcaggaattggacaaaatgctttggcaatacgaagccgagagtttcattccgcacgaa
atttgggaaatggaagaagccatgccgtctgaaacatccgtcctgcttgcttgcggcggc
aatccgccccgaattcccgaaggcatgactgttttgaacctgtccgacggtttttggaac
accgctccggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcttggaagatctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcataa

DBGET integrated database retrieval system