KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1294Help
Entry
NMAA_1294         CDS       T01931                                 

Definition
putative phospholipid hydroperoxide glutathione peroxidase (PHGPx) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMAA_1294
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMAA_1294
Enzymes [BR:nmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMAA_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1535182..1535715)
Genome map
AA seq 177 aa AA seqDB search
MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILD
FPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNH
LFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttgtcaggc
tatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgaccccgcaa
tacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagattttggat
tttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcccaagtg
tgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaatggagca
aataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggcaatcat
ctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaaggcgac
atcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgagcgtttt
gcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system