KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1408Help
Entry
NMAA_1408         CDS       T01931                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMAA_1408 (folP)
Enzymes [BR:nmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NMAA_1408 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649271..1650128)
Genome map
AA seq 285 aa AA seqDB search
MARHVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRLGADYVSPEEEWARVEPVLEEVAGWGVPVSLDTRRTVIMEKALALGGVDIIND
VAALNDEGAVELLARQADTGICLMHMQGLPKTMQINPKYQDVVGEVARYLKARSAECIAA
GIAPQRIILDPGFGSGFGKTLQHNIALMRHLPELMAETGFPLLIGVSRKSTIGELTGEAN
AAERVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggtatcgtgaatctcacgcccgattctttttccgacggcggcgcgtattcgcaaaac
gcccaaaccgctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggcgaatcgacgcggctgggtgcggattatgtttcgcctgaagaagaatgggcg
cgggttgagcctgtattggaggaagtggcggggtggggcgttcccgtcagtttggacacg
cgccgcacggtgattatggaaaaagcgttggcactcggcggcgtcgatattattaatgat
gtggcggcgttgaatgacgagggcgcggtcgaattgctggcgcgtcaggcggacacgggc
atttgcctgatgcacatgcagggtttgcccaaaaccatgcagattaatccgaaatatcaa
gatgttgtcggtgaagtagcgcggtatttgaaagcgcgctcagcggaatgtatcgcggca
ggcatcgcaccgcaacgcatcatactcgaccccggcttcggctccggcttcggcaaaacc
ttgcaacacaatatcgcgctgatgcggcatttgcccgaattgatggcggaaacaggtttt
ccgctgctcatcggcgtatcgcgcaaaagcacgataggcgagctgaccggcgaggcaaat
gcggcggaacgcgtacacggcagcgtggcggcagcgttggcttccgtggcgcgcggcgcg
caaatcgtgcgggtgcatgatgtgaaggcgacggcggatgcattgaaggtgtgggaagcg
ttgggcatcaatctgtaa

DBGET integrated database retrieval system