KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1408Help
Entry
NMAA_1408         CDS       T01931                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649271..1650128)
Genome map
AA seq 285 aa AA seqDB search
MARHVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRLGADYVSPEEEWARVEPVLEEVAGWGVPVSLDTRRTVIMEKALALGGVDIIND
VAALNDEGAVELLARQADTGICLMHMQGLPKTMQINPKYQDVVGEVARYLKARSAECIAA
GIAPQRIILDPGFGSGFGKTLQHNIALMRHLPELMAETGFPLLIGVSRKSTIGELTGEAN
AAERVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggtatcgtgaatctcacgcccgattctttttccgacggcggcgcgtattcgcaaaac
gcccaaaccgctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggcgaatcgacgcggctgggtgcggattatgtttcgcctgaagaagaatgggcg
cgggttgagcctgtattggaggaagtggcggggtggggcgttcccgtcagtttggacacg
cgccgcacggtgattatggaaaaagcgttggcactcggcggcgtcgatattattaatgat
gtggcggcgttgaatgacgagggcgcggtcgaattgctggcgcgtcaggcggacacgggc
atttgcctgatgcacatgcagggtttgcccaaaaccatgcagattaatccgaaatatcaa
gatgttgtcggtgaagtagcgcggtatttgaaagcgcgctcagcggaatgtatcgcggca
ggcatcgcaccgcaacgcatcatactcgaccccggcttcggctccggcttcggcaaaacc
ttgcaacacaatatcgcgctgatgcggcatttgcccgaattgatggcggaaacaggtttt
ccgctgctcatcggcgtatcgcgcaaaagcacgataggcgagctgaccggcgaggcaaat
gcggcggaacgcgtacacggcagcgtggcggcagcgttggcttccgtggcgcgcggcgcg
caaatcgtgcgggtgcatgatgtgaaggcgacggcggatgcattgaaggtgtgggaagcg
ttgggcatcaatctgtaa

DBGET integrated database retrieval system