KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1476Help
Entry
NMAA_1476         CDS       T01931                                 

Definition
putative phospholipase A1 (detergent-resistant phospholipase A; DR-phospholipase A; phosphatidylcholine 1-acylhydrolase; outer-membrane phospholipase A; OM PLA) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMAA_1476
   00565 Ether lipid metabolism
    NMAA_1476
   00590 Arachidonic acid metabolism
    NMAA_1476
   00591 Linoleic acid metabolism
    NMAA_1476
   00592 alpha-Linolenic acid metabolism
    NMAA_1476
Enzymes [BR:nmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NMAA_1476
    3.1.1.32  phospholipase A1
     NMAA_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723216..1724424)
Genome map
AA seq 402 aa AA seqDB search
MAERVRFLSESAIKCRLKTNMPTMGAEMNTRNMRYILLTGLLPMASAFGETALQCAALTD
NVTRLACYDRIFAAQLPSSAGQEGQESKAVLNLTETVRSSLDKGEAVIVVEKGGDALPAD
SAGETADIYTPLSLMYDLDKNDLRGLLGVREHNPMYLMPLWYNNSPNYAPGSPTRGTTVQ
EKFGQQKRAETKLQVSFKSKIAEDLFKTRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYK
PEIFLTQPVKADLPFGGRLRMLGAGFVHQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPR
VWVRAFDQSGDKNDNPDIADYMGYGDVKLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTF
PIKGKLKGVVRGFHGYGESLIDYNHKQNGIGIGLMFNDLDGI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagggtgcggtttttatccgaatccgctataaaatgccgtttgaaaaccaat
atgccgacaatgggggcggagatgaatacacggaatatgcgctatattcttttgacagga
ctgttgccgatggcatccgcttttggagagaccgcgctgcaatgcgccgctttgacggac
aatgttacgcgtttggcgtgttacgacaggatttttgcggcacagcttccgtcttcggca
gggcaggaagggcaggagtcgaaagccgtactcaatctgacggaaaccgtccgcagcagc
ctggataagggcgaggcggtcattgttgttgaaaaaggcggggatgcgcttcctgccgac
agtgcgggcgaaaccgccgacatctatacgcctttgagcctgatgtacgacttggacaaa
aacgatttgcgcgggctgttgggcgtacgcgaacacaatccgatgtaccttatgccgctc
tggtacaacaattcgcccaactatgccccgggttcgccgacgcgcggtacgactgtacag
gaaaaattcggacagcagaaacgtgcggaaaccaaattgcaggtttcgttcaaaagcaaa
attgccgaagatttgtttaaaacccgcgcggatctgtggttcggctacacccaaagatcc
gattggcagatttacaaccaaggcaggaaatccgcgccgttccgcaatacggattacaaa
cctgaaattttcctgacccagcctgtgaaggcggatttgccgttcggcggcaggctgcgt
atgctcggtgcgggttttgtccaccagtccaacggacagagccgtcccgaatcgcgttcg
tggaacaggatttacgccatggcaggcatggaatggggcaaattgacggtgattccgcgc
gtgtgggtgcgtgcgttcgatcagagcggcgataaaaacgacaatcccgatattgccgac
tatatggggtatggcgacgtgaagctgcagtaccgcctgaacgacaggcagaatgtgtat
tccgtattgcgctacaatcccaaaacgggctacggcgcgattgaagccgcctacacgttt
ccgattaagggcaaactcaaaggcgtggtacgcggattccacggttacggcgagagcctg
atcgactacaaccacaagcagaacggtatcggtatcgggttgatgttcaacgacttggac
ggcatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system