KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1521Help
Entry
NMAA_1521         CDS       T01931                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthetase; meso-diaminopimelate-adding enzyme; UDP-MurNAc-tripeptide synthetase) (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMAA_1521 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMAA_1521 (murE)
Enzymes [BR:nmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NMAA_1521 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783823..1785301)
Genome map
AA seq 492 aa AA seqDB search
MFSKLTPLAETGIPTLSCANAAGRLLHSDSRQIKQGDIFVACPGEYADGRSYIPAAVANG
AAFVFWDDDGKFAWNPEWKVPNQGIKDLKHRAGILAAQVYGNVSDGLKFWGVTGTNGKTS
ITQWLAQAADLLGEKTAIVGTVGNGFWGALEETTHTTPAPVDVQTLLYRFRQQGATVAAM
EVSSHGLDQSRVNGVSFRSAIFTNLTRDHLDYHGTMEAYGAIKSRLFYWHGLKHAVINVD
DGYGAELIGRLKKDCPDLAVYSYGFSEHADIRITDFTASSDGIEAVFRTPWGEGKCHTRL
LGRFNAQNLAACVALLCANGYPLDKVLDVLEKIRPASGRMDCIMNSGKPLVVVDYAHTPD
ALEKALATLQEIKPQGAALWCVFGCGGNRDRGKRLLMGAAAVQGADKVVVTSDNPRLENP
HDIINDILPAVPAPECVEADRAAAIRYAVEQAAANDIILIAGKGHENYQDVQGVKHRFSD
LEIVGQALLTRK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaagttaacccctttggctgaaaccggcatcccgaccctgtcgtgtgcaaac
gcggcagggcgtttgttgcattcagacagccgccaaatcaaacaaggcgatattttcgtt
gcctgtccgggcgaatatgccgacggacgcagttatatccccgccgccgttgccaacggc
gcggcttttgttttttgggacgacgacggcaaatttgcgtggaatcccgaatggaaagtc
cccaatcaaggcatcaaagatttgaaacaccgtgccggcatattggcggcgcaagtttac
ggcaacgtttcagacggtctcaaattctggggcgtaaccggaaccaacggcaaaacctcc
atcacgcaatggctggcgcaagctgccgatttgttgggcgaaaaaaccgccattgtcggc
acggtcggcaacggcttttggggtgcattggaagaaaccacgcataccacacccgccccc
gtcgatgtccaaaccctgctctaccgtttccgtcaacaaggcgcaacagtcgccgcgatg
gaagtctccagccacgggcttgaccagtcgcgcgtcaacggcgtgtcattccgcagcgca
atctttaccaacctcacccgcgaccacctcgactaccacggcacgatggaagcctacggt
gccatcaagtcgcgcctgttttactggcacggcttgaaacacgcagtcatcaacgtggat
gacggatacggcgcagaactcataggccgtctgaaaaaagactgccccgatttggccgtt
tacagttacggcttcagcgaacacgccgacatccgcattaccgactttaccgcctcttca
gacggcatagaagccgtattccgaaccccgtggggcgaagggaaatgccacacgcgcctg
ctcggacggttcaacgcgcaaaatctcgccgcctgtgtcgctttgctttgcgccaacggc
tatccgctggataaggtattggatgtactggaaaaaatccgtcctgcttcaggccgtatg
gattgtattatgaacagcggcaaacctttggtcgttgtcgattatgcccacacgcccgac
gcattggaaaaagcactcgccaccttgcaggaaatcaaaccgcagggtgcggctttgtgg
tgcgtattcggttgcggcggtaaccgcgatcgcggcaaacgcctgctgatgggcgcggca
gccgtacagggcgcggataaagtcgtcgtcaccagcgacaatccgcgtttggaaaatccg
cacgacatcatcaacgacatcctgcctgccgttcccgcgcccgaatgcgtcgaagccgac
cgtgccgccgccatccgttatgcggttgaacaagccgccgcaaacgacatcatcctgatt
gccggcaaagggcatgaaaactatcaggatgtacaaggcgtgaagcaccgtttttccgat
cttgaaatcgtcggacaggctttgttaactcgtaaataa

DBGET integrated database retrieval system