KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1539Help
Entry
NMAA_1539         CDS       T01931                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase (mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00010  Glycolysis / Gluconeogenesis
nmw00052  Galactose metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
nmw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMAA_1539 (galM)
   00052 Galactose metabolism
    NMAA_1539 (galM)
Enzymes [BR:nmw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NMAA_1539 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF3187
Motif
Other DBs
NCBI-ProteinID: CBY91478
Position
complement(1813355..1814365)
Genome map
AA seq 336 aa AA seqDB search
MSDTPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVRENLVVSFDD
AASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHGLAVTRFNAV
AADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDDRLTVSYRATALGDTVFDPTLHIYW
RLDAGLHDAVLHIPQGGHIPADAEKLPVSTVSDDLEVFDFSRPKPLDAAVAALRRETGRA
GFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATE
AQTLPDSLNWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccgcgattttggcctgatcgacgggcgtgccgtaaccggc
tatgtgctgtccaaccggcgtggtacgcgtgtctgcgtgctggacttgggcgggattgtg
caggaattttccgttttggcagacggcgtgcgcgaaaacctcgtggtgtcgttcgacgat
gcggcttcctatgcggacaatccgtttcagattaacaagcagatagggcgcgtggccgga
cgcatccgcggtgcggcgttcgacatcaacggcaggacttaccgcgtggaggccaacgaa
ggcaggaacgcgctgcacggcggttcgcacgggctggccgttacccgtttcaacgcggtg
gcggcagacggccgttcggtggtgctgcgcagccgcctgcaacagtcggccgacggttat
cccaacgatttggatttggatatttcctaccgcttggacgaggacgaccggcttaccgtt
agctatcgcgccaccgcgctcggcgacacggtgttcgacccgacgctgcacatttactgg
cggctggacgcgggcctgcacgatgcggttctgcatattccgcagggcggacatattccg
gccgatgccgaaaaactgcccgtctcaacggtttcagacgacctcgaagtatttgatttc
agccggcccaagccgctggatgccgccgttgccgccctgcgccgcgaaacgggtcgggcc
ggttttgacgacgcttaccgcgtgccgtccgatataggccgtcccgccgctgtgttgcaa
gccggacgccgccgtcgtatcagcatatacagcgaccgcaatggcttggtcatctttacc
gccgccccgcaggatttcgcgcggcacgatgcgggcgtttacgacgcgctggcgaccgag
gcgcagacgctgcccgacagcctgaattggcccgagttcggcaatattcgtctgaacaag
ggtgataccagggaggcgacgattgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system