KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1705Help
Entry
NMAA_1705         CDS       T01931                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01130  Biosynthesis of antibiotics
nmw01230  Biosynthesis of amino acids
Module
nmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMAA_1705 (trpC)
Enzymes [BR:nmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMAA_1705 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: CBY91648
Position
1973690..1974472
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPPEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEREQLERFEAVAHELGMTVLLELHDESELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgcgcccgtccgcagc
tttatcggttcgatacgcggcaaacaccgcctcaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaagggttaatccgtccggacttccgaccgcccgagattgca
cgcgcctatgaaaacgccggggcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcctggggggcggatgcc
gtcctgctgattgccgccgcactggaacgggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgatgaaagcgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggcgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggtaaggcggatgtggaatttatgcaatcgcgcggcgtgcataccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattgaagcagaagtgggcaaactcttc
taa

DBGET integrated database retrieval system