KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1705Help
Entry
NMAA_1705         CDS       T01931                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (IGPS) (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMAA_1705 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMAA_1705 (trpC)
Enzymes [BR:nmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMAA_1705 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1973690..1974472
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILTAKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIGSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPPEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEREQLERFEAVAHELGMTVLLELHDESELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttaccgccaaggcacaggaagttgccgcccaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgcgcccgtccgcagc
tttatcggttcgatacgcggcaaacaccgcctcaacctgcccgccgtcattgccgaaatc
aaaaaggcaagcccgagcaaagggttaatccgtccggacttccgaccgcccgagattgca
cgcgcctatgaaaacgccggggcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgacgaatatcaggtttatcaggcgcgcgcctggggggcggatgcc
gtcctgctgattgccgccgcactggaacgggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgatgaaagcgaattggaaaaatgc
cgcaacctgaccacgccgttgtggggcgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacaggtaaggcggatgtggaatttatgcaatcgcgcggcgtgcataccttc
ctgatcggcgaaacgtttatgcgtgccgacgatattgaagcagaagtgggcaaactcttc
taa

DBGET integrated database retrieval system