KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1907Help
Entry
NMAA_1907         CDS       T01931                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase; dTDP-L-rhamnose synthetase) (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMAA_1907 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMAA_1907 (rfbC2)
Enzymes [BR:nmw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMAA_1907 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183383..2183955
Genome map
AA seq 190 aa AA seqDB search
MKDKKMNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVCNRTFVQENHSKSGKG
VLRGLHYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGF
AHGFCVLGDAAEVVYKCTDYYKPEAEQVLIWNDPTVGIGWPLQGEPNLSPKDLAGKTWAQ
AEKLRLPLSR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaaaagatgaacatcattgataccgccattcctgacgtaaaactgcttgag
ccccaagtcttcggcgacgcgcgcggcttttttatggaaaccttccgcgacgaatggttc
aagacccaagtctgcaaccgcaccttcgtgcaggaaaaccactccaaatccggcaaaggc
gtattgcgcggcctgcactaccaaaccgaaaacacacaaggcaaactcgtacgcgtagtt
gtcggcgaagtgttcgacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaa
tgggcgggcgcaaccctgtccgcgcaaaaccaatgccagctttggatacccgaaggcttc
gcgcacgggttttgcgttttgggcgacgcggcggaagtcgtgtacaaatgcaccgactat
tacaagcctgaagccgaacaggttttaatatggaacgacccgacagtcggcataggctgg
ccgttgcaaggcgagccgaacctgtcgcccaaagaccttgccggcaaaacgtgggcgcaa
gccgaaaagctccgccttccgctttccagataa

DBGET integrated database retrieval system