KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_1936Help
Entry
NMAA_1936         CDS       T01931                                 

Definition
putative nicotinamidase (nicotine deamidase; NAMase) (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:nmw00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2221525..2222160)
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPKELPVNEGHLIVEELNAQAALADLRVMTKDAHHMVAKWLVDN
PVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPSAKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTDMVIVGGLATDYCVKTTVLQLLKGSNWQVIVNEAACRGIAP
DTIETAWQEMRSAGAVILKNAEEIKKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacttttacgcctttgtgtcctaaagag
ctgcctgtaaacgaggggcatttgattgtcgaagaattgaatgcccaagccgctttggcg
gatttgcgcgtgatgacgaaagatgcgcatcatatggtagcgaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttgcctgatgcggatttgacttgggtggctcat
gcgatggtcggtacgcgcggctatgaattattggacggactgccttctgccaaagaatac
gattattgcgtttggaaaggtgttgatcctgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactgagcactggattgattgagtggctgcgttgtcaaaatacggat
atggtcattgtcggcggtttggctacggattattgtgttaaaacaacggttttgcagttg
ctcaaaggtagcaattggcaggttatcgtcaatgaagcggcttgtcggggtattgcgccg
gataccattgaaacggcatggcaggaaatgcgttctgccggtgctgtcatcttaaaaaac
gccgaagaaattaaaaaatatattaataatcaataa

DBGET integrated database retrieval system