KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0067Help
Entry
NMBNZ0533_0067    CDS       T01949                                 

Gene name
rfbC1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMBNZ0533_0067 (rfbC1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBNZ0533_0067 (rfbC1)
Enzymes [BR:nmz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMBNZ0533_0067 (rfbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67608..68165)
Genome map
AA seq 185 aa AA seqDB search
MNIIDTAIPDVKLLEPQVFGDARGFFMETFRDGWFKENIADCSFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGFAHGFY
VLSDTTELTYKCTDYYKPEAEQVLIWNDPAIGIGWPLQTAPLLSPKDLAGKTWAQAEKLR
LTLSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgataccgccattcctgacgtaaaactgcttgagccccaagtcttcggc
gacgcgcgcggcttttttatggaaaccttccgcgacgggtggttcaaagaaaatattgcc
gactgttcctttgttcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtagttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatgggcgggcgcaacc
ctgtccgcgcaaaaccaatgccagctttggatacccgaaggcttcgcgcacgggttttac
gttttgagcgacacgaccgaacttacctacaaatgcacggactattacaagcctgaagcc
gaacaggttttaatatggaacgacccggcaatcggcataggctggccgcttcaaaccgcg
ccgctgctgtcgcccaaagaccttgccggcaaaacgtgggcgcaagccgaaaagctccgc
cttacactttcccgataa

DBGET integrated database retrieval system