KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0086Help
Entry
NMBNZ0533_0086    CDS       T01949                                 

Gene name
rfbC2
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00521  Streptomycin biosynthesis
nmz00523  Polyketide sugar unit biosynthesis
nmz01130  Biosynthesis of antibiotics
Module
nmz_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMBNZ0533_0086 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBNZ0533_0086 (rfbC2)
Enzymes [BR:nmz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMBNZ0533_0086 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF1255
Motif
Other DBs
NCBI-ProteinID: ADZ02577
UniProt: A0A0E0TNP3
Position
89407..89946
Genome map
AA seq 179 aa AA seqDB search
MNIIDTRIPDVKLLEPKVFGDERGFFMETFRDEWFRQNVAERTFVQENHSKSTQGVLRGL
HYQTENTQGKLVRVVSGEVFDVAVDMRRDSPTFGHWVGEVLSADNKRQLWVPEGFAHGFY
VLSDEAEFVYKCTDYYNPNAEHSLIWNDATVGIDWPLLGEPSLSAKDLAGKMLAEAATF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatcgatacccgcattcccgatgtcaaattgctcgaacccaaagtcttcggt
gacgagcgtggtttttttatggaaaccttccgtgatgaatggttccgccaaaatgtagcc
gagcgcactttcgtgcaggaaaaccacagcaaatccacccaaggcgtattacgcggttta
cattatcaaaccgaaaatacacaaggcaaactggtgcgcgtggtatcaggcgaagtcttt
gatgttgccgtggatatgcgtcgtgatagtcctactttcggccactgggtcggtgaggtt
ttatcggcagacaacaaacgccaattatgggtgccggaagggtttgcccatggattttat
gtgttgagcgatgaagcggaattcgtctacaaatgcaccgactattacaacccgaatgcg
gaacattccctaatttggaatgatgccacagtgggaatcgactggcctttattgggagaa
ccaagcctatcggccaaggatttggcaggcaagatgcttgctgaagcggccacattttaa

DBGET integrated database retrieval system