KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0188Help
Entry
NMBNZ0533_0188    CDS       T01949                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMBNZ0533_0188 (dxr)
Enzymes [BR:nmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NMBNZ0533_0188 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183811..184995)
Genome map
AA seq 394 aa AA seqDB search
MTPQVLTILGSTGSIGESTLDVVSRHPEKFRVFALAGHKQVEKLAVQCRTFRPEYAVVAD
AEHAARLEALLKGDGTATQVLHGAQALVDVASADEVSGVMCAIVGAVGLPSALAAAQKGK
TIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAIFQVLPRDYAGRLNEHGIASIIL
TASGGPFLTADLNTFDSITPAQAVKHPNWSMGRKISVDSATMMNKGLELIEAHWLFNCPP
DKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGLPERIDSGVGDLDFDALS
ALTFQKPDFDRFPCLKLAYEAMNAGGAAPCVLNAANEAAVAAFLDGQIKFTDIAKTVAHC
LSQDFSDGIGDIGGLLAQDARTRAQARAFIGTLR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacaagtcctgaccatattaggcagtaccggcagcataggcgaaagcacgctg
gacgttgtctcccgccaccccgaaaaattccgcgtattcgcgctggcagggcataagcag
gtcgagaaactggcggtgcaatgccggacgttccgccccgaatatgccgtcgttgccgat
gccgaacacgccgcccggcttgaagctttgttgaaaggcgacggcacggcgacgcaggtt
ttacacggcgcgcaggcattggttgacgttgcctctgccgacgaagtcagcggtgtcatg
tgcgccatcgtcggggcggtggggctgccttccgcgctcgcagcggcgcaaaaaggcaaa
accatttatctggcgaacaaagagacgctggtggtttccggcgcgttgtttatggaaacc
gcccgtgcaaacggcgcggcagtgctgcccgtcgacagcgaacacaacgccattttccaa
gttttgccgcgcgattacgccggccgtctgaacgaacacggcatcgcttcgattatcctg
accgcttccggcggcccgtttctgaccgccgatttaaacacgttcgacagcattacgccc
gcccaagcggtcaaacaccccaattggagcatggggcgcaaaatctccgtcgattccgcc
accatgatgaacaaaggtttggagctgattgaagcgcattggctgttcaactgtccgcct
gacaagctcgaagtcgtcatccatccgcaatccgtgatacacagcatggtgcgctaccgc
gacggctccgtgttggcgcaactgggcaatcccgatatgcgtacgcccattgcttattgt
ttgggtttgcccgagcgcatcgattcgggtgtcggcgacctggatttcgacgcattgtcc
gcgctgaccttccaaaagcccgactttgaccgcttcccctgcctgaagctcgcctatgaa
gccatgaacgcaggcggagccgcgccctgcgtattgaacgccgccaacgaagccgccgtc
gccgcctttttggacggacagattaagtttaccgacattgccaaaaccgtcgcccattgt
ctttcacaagacttttcagacggcataggcgacataggggggctcttggcgcaagatgcc
cggacacgcgcacaagcgcgggcatttatcggcacactgcgctga

DBGET integrated database retrieval system