KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0441Help
Entry
NMBNZ0533_0441    CDS       T01949                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00010  Glycolysis / Gluconeogenesis
nmz00051  Fructose and mannose metabolism
nmz00562  Inositol phosphate metabolism
nmz01100  Metabolic pathways
nmz01110  Biosynthesis of secondary metabolites
nmz01120  Microbial metabolism in diverse environments
nmz01130  Biosynthesis of antibiotics
nmz01200  Carbon metabolism
nmz01230  Biosynthesis of amino acids
Module
nmz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBNZ0533_0441 (tpiA)
   00051 Fructose and mannose metabolism
    NMBNZ0533_0441 (tpiA)
   00562 Inositol phosphate metabolism
    NMBNZ0533_0441 (tpiA)
Enzymes [BR:nmz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMBNZ0533_0441 (tpiA)
Exosome [BR:nmz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMBNZ0533_0441 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMBNZ0533_0441 (tpiA)
  Exosomal proteins of melanoma cells
   NMBNZ0533_0441 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ02907
UniProt: A0A0E0TPN4
Position
complement(462189..462962)
Genome map
AA seq 257 aa AA seqDB search
MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccaaaacaacaacgcactgatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctc
caaggactggacaccaaaaacatcgccgtcgcctacgaacccgtctgggcaatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgtgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system