KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0443Help
Entry
NMBNZ0533_0443    CDS       T01949                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Brite
Enzymes [BR:nmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMBNZ0533_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD CMAS Methyltransf_11 Methyltransf_18 Methyltransf_12 Methyltransf_23 MTS Ubie_methyltran Aconitase_2_N Methyltr_RsmB-F DUF938 Methyltransf_3 Methyltransf_9 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADZ02909
UniProt: A0A0E0TNF6
Position
463751..464407
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYAAALLAKLAGRVVSDDIDAEQQKRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMAVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDADPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgacgttttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacgggcataagatg
ctcgagccgaaagttgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggatcgggctatgcggccgcgctgttggcgaaactggctggt
cgtgtggtttcggacgacatcgatgccgaacagcaaaagcgcgccaaagcggttttggac
ggcttgtctttggaaaacattgattatgtgcaaaacaacgggctgaccgaactttccgca
ggcgcgccgtttgatgcggtttatgtcggcggcgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggcggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatact
ttggtggcgcatttggatgataaggatgccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system