KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0568Help
Entry
NMBNZ0533_0568    CDS       T01949                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMBNZ0533_0568 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NMBNZ0533_0568 (nagZ)
Enzymes [BR:nmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NMBNZ0533_0568 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(615742..616827)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTGEERQRLLDPAIGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHHNPEAVAHLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDRRSLSELEAADLAPFHIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTADFQEAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accggagaagaaaggcaacgcctgctcgaccccgcaatcggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccacaatcccgaagcggtcgcccacctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacgga
tttgtcgaaggagacagccatctggtcttgccggaagacaggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccacattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgacatcgggtttaaaggcgtaattttctcggatgatttg
actatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatacatggccaacacg
ctcggcagtgccgccgcgcaagccgttatgcagacggcggatttccaagaggcgcaagcc
tttgttgccggccttgcctcgccgcaagacacggcgggcggcgtaaaagtcggcgaagcc
ttttaa

DBGET integrated database retrieval system