KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0828Help
Entry
NMBNZ0533_0828    CDS       T01949                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBNZ0533_0828 (hemD)
Enzymes [BR:nmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMBNZ0533_0828 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881064..881804
Genome map
AA seq 246 aa AA seqDB search
MLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVFWVSPTAV
ETAVPYLNLSDGIKIHIAVGQGSRRALERYLGRTVIAPHDGNDSEAVLRLPVWNSLPEGA
RVLFVRGHGGRDFLMNALQEKGFRTEMAEVYFRRHKPLNFQNFQTENIAAAYITSTELVR
LLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSISVSDGMV
FPGTSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgtccgaccgtcgggcagggcgaaggacgatgtggaaacctgccgtcgtgcc
ggatggcaggcggaagtgttgagcccgattgaaatcgaagcagatgctgccggactggaa
cttttgtccgaacaatatgcccgtgcggatgccgtgttttgggtcagtccgaccgccgtt
gaaaccgccgtcccgtaccttaacctttcagacggcataaagatacacattgccgtaggg
cagggcagccgccgcgcattggaacgctatttgggcagaacggtcattgcgcctcatgac
ggaaacgacagcgaggcggttttgcgcctgccggtttggaacagtctgcccgaaggtgca
cgcgtattgtttgtgcgcggacacggcgggcgggattttctgatgaatgccttgcaggag
aaaggttttcggacggagatggcagaagtctatttcagacggcataaacctttgaacttt
caaaatttccaaaccgaaaatattgccgccgcctatattacgtcgaccgagctggtgcgc
ttgctgttcgggcagcttccgccgcaattttcccgattcttcaaatccttgctatacttt
acccatcatccgcgcattgcggaggcattgaagcgcgaaggcgtgtgttcggtcgaaacc
gtccctacgctggaagccgcgctttcccattcttccatttccgtttcagacggcatggtc
tttcccggaacctcaaattaa

DBGET integrated database retrieval system