KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0840Help
Entry
NMBNZ0533_0840    CDS       T01949                                 

Gene name
pgm
Definition
(GenBank) phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00010  Glycolysis / Gluconeogenesis
nmz00030  Pentose phosphate pathway
nmz00051  Fructose and mannose metabolism
nmz00052  Galactose metabolism
nmz00230  Purine metabolism
nmz00500  Starch and sucrose metabolism
nmz00520  Amino sugar and nucleotide sugar metabolism
nmz00521  Streptomycin biosynthesis
nmz01100  Metabolic pathways
nmz01110  Biosynthesis of secondary metabolites
nmz01120  Microbial metabolism in diverse environments
nmz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBNZ0533_0840 (pgm)
   00030 Pentose phosphate pathway
    NMBNZ0533_0840 (pgm)
   00051 Fructose and mannose metabolism
    NMBNZ0533_0840 (pgm)
   00052 Galactose metabolism
    NMBNZ0533_0840 (pgm)
   00500 Starch and sucrose metabolism
    NMBNZ0533_0840 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBNZ0533_0840 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMBNZ0533_0840 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBNZ0533_0840 (pgm)
Enzymes [BR:nmz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMBNZ0533_0840 (pgm)
    5.4.2.8  phosphomannomutase
     NMBNZ0533_0840 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADZ03286
UniProt: A0A0E0TPT0
Position
complement(895469..896851)
Genome map
AA seq 460 aa AA seqDB search
MANIARDIFKAYDIRGIVGKTLTDDAAYLIGRAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIIEKDGFVAADKQGNVTEKDISGEYHNHIVGHIKLKRPMNIAIDAGNGV
GGAFAGKLYKGLGNEVTELFCDVDGNFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPKAKVIFDVKSTRLLAPWIKEHGGEPVM
EKTGHSFIKSSMKKTGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgcccgcgacatcttcaaagcctacgacatccgaggcattgtcggcaaa
accctgaccgacgatgccgcctatctcatcggcagggccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgccatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagccattattgaaaaagacggttttgttgcc
gccgacaaacaaggcaacgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggccacatcaaactcaaacgcccgatgaacatcgctatcgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctataaaggcttgggcaacgaagtaaccgagcttttc
tgcgacgtggacggcaatttccccaaccaccatcccgacccatccaaacccaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtagttaccaaagacggcaacatcatctatccagaccgccaa
ctgatgcttttcgcgcaagacgtgttgagccgcaatcctaaagccaaagtaattttcgac
gtcaaatccacccgtctgcttgcgccttggattaaagaacacggcggcgaacctgtgatg
gaaaaaaccggccacagctttatcaaatcctccatgaaaaaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system