KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0850Help
Entry
NMBNZ0533_0850    CDS       T01949                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBNZ0533_0850 (hemB)
Enzymes [BR:nmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NMBNZ0533_0850 (hemB)
Exosome [BR:nmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMBNZ0533_0850 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904697..905698
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEGSAREEDVPSMQGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTERAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDMMDGRIG
AIREALEDAGHIHTLIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
HEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVANGWLDG
DKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggacgat
ttttcacgccgcctgatgcgcgaacacacgctgaccgccgatgatttgatttatccggtg
ttcgtattggaggggtcggcgcgcgaggaggatgtgccttctatgcagggcgtgaagcgt
cagagtttggacaggctgctgtttacggcggaagaggcggtaaagctcggtattccgatg
ttggcactctttcccgtggttacggcaaacaaaactgagcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgagccttgcgcgagaggtttcctgaactgggc
attatgacggatgtcgcgctcgatccttatacggttcacggtcaggacgggctgacggac
gaaaacggttatgtgatgaacgatgaaaccgtagaggttttggtcaagcaggctttgtgc
cacgctgaagcgggcgcacaggtggttgctccttccgatatgatggacgggcgtatcggt
gcgattcgcgaggcgttggaggatgccgggcatatccatacgctgattatggcgtattcc
gccaaatatgcttctgcattttacggccctttccgtgatgcggtgggcagttcgggcaat
ttgggcaaggcggacaagaaaacctaccagatggatccggcaaataccgatgaggcgttg
cacgaagtggcgttggacattcaggaaggtgcggatatggtaatggtcaagcctggtttg
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggtgtgccgacttatgcctat
caggtttcgggcgaatatgcgatgctacaggcggcggttgccaacggatggctggatggc
gataaagtggttttggaaagcctgctggcattcaaacgtgcgggcgcggatgggattttg
acctattatgccattgaggcggccaagatgctgaagcgttga

DBGET integrated database retrieval system