KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0918Help
Entry
NMBNZ0533_0918    CDS       T01949                                 

Gene name
ispE
Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nmz00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969275..970120
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGKREDGYHNIESIFCLIDLQDTVYLKLRDDGKIILHN
PVDGMPQEVDLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCSRTTQQLIDLGATLGADVPFFIFGKNAFASGIGEKLIGMDIPKQWYVIVKPPVHVST
AKIFTHEGLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRDSAYNIYRQVSDLYEAYLAEGLSKHPWLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattactggaaagcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaactaagggacgacggcaaaatcatcctgcacaat
ccggttgatggaatgccgcaggaagtagatttaagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgttcccgaacgacgcagcagctgattgacttgggcgcaactttgggtgcggac
gtaccattttttattttcggaaaaaatgcttttgcaagcgggataggtgaaaaactgata
ggaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaggcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaacctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgaattgtcccgatatggatttgccttaatgacaggttct
ggtgcgtgtgtattcacggcgtgtcaagatagggatagcgcatacaatatataccgacaa
gtttcagatttgtacgaggcatatttggcagagggtctttcaaaacatccttggttgtcc
gtataa

DBGET integrated database retrieval system