KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_0999Help
Entry
NMBNZ0533_0999    CDS       T01949                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBNZ0533_0999 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBNZ0533_0999 (sdhD)
   00650 Butanoate metabolism
    NMBNZ0533_0999 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBNZ0533_0999 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1040194..1040535
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctg
gtcggctgtctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system