KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1005Help
Entry
NMBNZ0533_1005    CDS       T01949                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBNZ0533_1005 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBNZ0533_1005 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMBNZ0533_1005 (sucB)
Enzymes [BR:nmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBNZ0533_1005 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047908..1049074
Genome map
AA seq 388 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPVAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAGARPEERVPMSRLRARVAERLLASQQ
ENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVVNASVD
GKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIAIEDLT
GGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLALSYDHR
IIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtcccttccccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgcatcgatacagctgct
actgccgctgccgaagcacccgtagccgctcctgccgaagccgccccggctgccgctcct
gctgccgcacaaaacaacgccgctatgcctgccgccgccaaactggctgcggagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgcagcccctgccggcgcacgtcctgaagaa
cgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctcttggcttctcaacaa
gaaaacgccattctgactacattcaacgaagtcaacatgaaaccaatcatggacttgcgt
gcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaattgggctttatgtccttc
ttcgttaaagccgctgtcgccgccctgaaaaaatacccggttgtgaatgcttctgttgac
ggcaaagacatcgtgtaccacggctacttcgacatcggtatcgcgattggcagcccacgc
ggtttggttgtgccaatcctgcgcgatgccgaccaaatgagcattgccgacatcgaacaa
gcaattgttgattacgcgaaaaaagccaaagatggcaaaatcgctatcgaagatctgacc
ggcggtacattcagtattaccaacggcggtactttcggttctatgatgtctaccccgatc
atcaacccgcctcaatctgcgattttgggtatgcatgccactaaagagcgcgctgtggtt
gaaaacggtcaagttgttgtccgtccaatgatgtatctggctctgtcttacgaccaccgt
atcatcgacggtcgcgaagctgtattgactttggtagccattaaagacgcgttggaagac
ccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system