KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1008Help
Entry
NMBNZ0533_1008    CDS       T01949                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00020  Citrate cycle (TCA cycle)
nmz00640  Propanoate metabolism
nmz00660  C5-Branched dibasic acid metabolism
nmz01100  Metabolic pathways
nmz01110  Biosynthesis of secondary metabolites
nmz01120  Microbial metabolism in diverse environments
nmz01130  Biosynthesis of antibiotics
nmz01200  Carbon metabolism
Module
nmz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBNZ0533_1008 (sucC)
   00640 Propanoate metabolism
    NMBNZ0533_1008 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NMBNZ0533_1008 (sucC)
Enzymes [BR:nmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMBNZ0533_1008 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADZ03445
UniProt: A0A0E0TQH5
Position
1051382..1052548
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVKGVLINIFGGIVRCDMIAEAIVAAVKEINVDVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacatgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaaccgatgccaacggccaacctgtcaacagcgttttggtttgtgaa
gatatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggtggcgtagaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggcgcgtacaaagcgtttgtcgaaaacgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccaaaaatcgctgaattgcgcgacaaatctcaagaaaac
gaacgtgaactgaaagcttctgaattcgacctgaactatgttgccctggaaggcaacatc
ggctgtatggttaacggtgccggtttggcgatggccaccatggacatcatcaaactcaaa
ggcggtcaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattttggaagacaaatccgttaaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcgacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system