KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1230Help
Entry
NMBNZ0533_1230    CDS       T01949                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nmz00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nmz00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267667..1269076
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGSAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
NATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPAEINTLWAEVAAGKGFDLRFALDKVGG
KYGFTSGKSTHADRLATIKQVYEQDQELIDPHTADGVKVAREVREEGEMVVCLETALAAK
FDATIREAVGDAAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcccccgacggcggtctgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggttcggcttatcccgaattggcgtttgaaattatgcgc
ctgttcgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcaatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcg
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaagggcgtgaac
gtatttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcaaatgtacagc
ctgcaagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggat
attgtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aactcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aacgccacttcaagcaatgacgaaaccgtcagcttctgcgtaccgagcggcaacttcggc
aatgtttgcgcgggacacattgccaaacaaatgggcctgcctatccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgc
aacagcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctgcggaaatcaatacgctgtgg
gcggaagtggctgcaggcaaaggctttgacctgcgatttgccttggacaaagtcggtggc
aaatacggttttacctctggcaaatccacccacgccgaccgcctcgccaccatcaagcag
gtttacgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggtgaaatggtggtttgtttggaaaccgcgttggcggcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccctgccgcgctg
gaaggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system