KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1377Help
Entry
NMBNZ0533_1377    CDS       T01949                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
nmz00010  Glycolysis / Gluconeogenesis
nmz00052  Galactose metabolism
nmz00500  Starch and sucrose metabolism
nmz00520  Amino sugar and nucleotide sugar metabolism
nmz00521  Streptomycin biosynthesis
nmz01100  Metabolic pathways
nmz01110  Biosynthesis of secondary metabolites
nmz01120  Microbial metabolism in diverse environments
nmz01130  Biosynthesis of antibiotics
nmz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBNZ0533_1377 (glk)
   00052 Galactose metabolism
    NMBNZ0533_1377 (glk)
   00500 Starch and sucrose metabolism
    NMBNZ0533_1377 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBNZ0533_1377 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBNZ0533_1377 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NMBNZ0533_1377 (glk)
Enzymes [BR:nmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMBNZ0533_1377 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADZ03799
UniProt: A0A0E0TR58
Position
complement(1444001..1444987)
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGASPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcggc
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcgcgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgcggcggcattattccccgcgtgttggaatatttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
ctcgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system