KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1670Help
Entry
NMBNZ0533_1670    CDS       T01949                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790657..1791508)
Genome map
AA seq 283 aa AA seqDB search
MARHGWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAKTALAHAERLLKEGADILD
IGGESTRPGADYVSSEEEWARVEPVLVEVAGWGVPVSLDTRRTVVMEKALALGGIDIIND
VAALTDEGAVELLARQTDTGICLMHMQGLPETMQINPKYQDVVGEVARYLKARAAECIAA
GIAPQRITLDPGFGFGKTLQHNIALMRHLPELMAETGFPLLIGVSRKRMIGELTGEADAA
ARVHGSVAAAVAAVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacggttggcaggcaggacggtttgaaatcggtttggacaagccgaaaatt
atgggcatcgtgaatctcacgcctgattctttttccgacggcggcgcgtattcgcaaaat
gccaaaaccgctttggcgcacgccgaacggcttttgaaagagggtgcggacattctcgac
attggcggcgaatcgacgcggccgggtgcggattatgtttcgtccgaagaagaatgggcg
cgggttgagcctgtattggtagaagtcgcgggatggggcgttcccgtcagtttggacacg
cgccgcacggtggttatggaaaaagcgttggcactcggcggcatcgatattattaacgat
gtggcggcgttgaccgacgaaggcgcggtcgaattgctggcgcgccagacggacacgggt
atttgcctgatgcatatgcagggtttgcctgaaaccatgcagattaatccgaaatatcag
gatgttgttggtgaagtggcgcggtatttgaaagcgcgggcggcggaatgcatcgcggca
ggcatcgccccgcaacgcatcacactcgaccccggtttcggtttcggcaaaaccttacaa
cacaatatcgcactgatgcggcatttacccgaattgatggcggaaacgggttttccgctg
ctcatcggcgtgtcgcgcaaacgtatgataggcgagctgactggcgaggcagacgcggcg
gcgcgcgtacacggcagcgtggcggcggctgtggcggctgtggcgcgcggcgcgcaaatt
gtgcgggtgcatgacgtgaaggcgacggcggacgcgttgaaggtgtgggaagcgttgggc
atcaatctgtaa

DBGET integrated database retrieval system