KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1782Help
Entry
NMBNZ0533_1782    CDS       T01949                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nmz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1931573..1932496)
Genome map
AA seq 307 aa AA seqDB search
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSGRSGARFGPEA
IRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDSRDFVEKMEAHAGKLLSSGKR
CLSLGGDHFITLPLLRAHARYFGKLALIHFDAHTDTYDNGSEYDHGTMFYTAPKEGLIDP
SRSVQIGIRTEHSKKLPFTVLTAPQVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSF
APGTGTPVCGGLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagcacactggcaggacaaaccgacaactccctcgtttccaataatttcggg
tttttgcgcctgccgcttaattttatgccgtatgaaagtcatgccgattgggttattacc
ggcgtgccttatgatatggcggtttcagggcgttccggcgcgcgtttcggtcctgaagcc
atccggcgcgcctccgtcaacctcgcttgggagcaccgcaggtttccatggacatttgat
gtgcgcgaacgcctgaacattattgattgcggcgacttggttttttcttttggcgacagc
agggattttgtcgaaaaaatggaagcgcacgccggcaaattactttcttccggcaaacgc
tgtttgagtttgggcggcgaccatttcattaccctaccgttgttgcgcgcccacgcccgc
tatttcggcaaactcgcactgattcattttgacgcgcacaccgacacctacgacaacggc
agcgaatacgaccacggtacgatgttctataccgcccccaaggaaggcctcatcgacccg
tcccgttccgtacaaatcggcatacgtaccgaacacagtaaaaaattgccttttactgtg
ttgaccgccccccaagtcaatgaagacagtgttgaagagaccgtccgtaaaatcaaagaa
accgtcggcaatatgcccgtttacctgactttcgacatcgactgcctggacccgtcgttc
gcccctgggaccggtacgcccgtatgcggcggcttgagcagcgacagggcattaaaaatc
ctacgtgggctgacggatctcgacatcgtcggtatggatgttgtagaagttgccccctct
tacgaccaatccgacattaccgctttggccggtgccacaattgccttggaaatgctttac
cttcaaggtgcgaaaaaggactga

DBGET integrated database retrieval system