KEGG   Neisseria meningitidis NZ-05/33 (serogroup B): NMBNZ0533_1787Help
Entry
NMBNZ0533_1787    CDS       T01949                                 

Gene name
pldA
Definition
phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
nmz  Neisseria meningitidis NZ-05/33 (serogroup B)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nmz00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:nmz00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nmz00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:nmz00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1937799..1938947)
Genome map
AA seq 382 aa AA seqDB search
MPTMGAEMNTRNMRYILLTGLLPMASAFGETALQCAALTDNVTRLACYDRIFAAQLPSSA
GQEGQESKAVLNLTETVRSSLDKGEAVIVVEKGGDALPADSAGETADIYTPLSLMYDLDK
NDLRGLLGVREHNPMYLMPLWYNNSPNYAPSSPTRGTTVQEKFGQQKRAETKLQVSFKSK
IAEDLFKTRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLR
MLGAGFVHQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIAD
YMGYGDVKLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVVRGFHGYGESL
IDYNHKQNGIGIGLMFNDLDGI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaatgggggcggagatgaatacacggaatatgcgctatattcttttgacagga
ctgttgccgatggcatccgcttttggagagaccgcgctgcaatgcgccgctttgacggac
aatgttacgcgtttggcgtgttacgacaggatttttgcggcacagcttccgtcttcggca
ggacaggaagggcaggagtcgaaagctgtactcaatctgacggaaaccgtccgcagcagc
ctggataagggcgaggcggtcattgttgttgaaaaaggcggggatgcgcttcctgccgac
agtgcgggcgaaaccgccgacatctatacgcctttgagcctgatgtacgacttggacaaa
aacgatttgcgcgggctgttgggcgtacgcgaacacaatccgatgtaccttatgccgctc
tggtacaacaattcgcccaactatgccccgagttcgccgacgcgcggtacgactgtacag
gaaaaattcggacagcagaaacgtgcggaaaccaaattgcaggtttcgttcaaaagcaaa
attgccgaagatttgtttaaaacccgcgcggatctgtggttcggctacacccaaagatcc
gattggcagatttacaaccaaggcaggaaatccgcgccgttccgcaatacggattacaaa
cctgaaattttcctgacccagcctgtgaaggcggatttgccgttcggcggcaggctgcgt
atgctcggtgcgggttttgtccaccagtccaacggacagagccgtcccgaatcgcgttcg
tggaacaggatttacgccatggcaggcatggaatggggcaaattgacggtgattccgcgc
gtgtgggtgcgtgcgttcgatcagagcggcgataaaaacgacaatcccgatattgccgac
tatatggggtatggcgacgtgaagctgcagtaccgcctgaacgacaggcagaatgtgtat
tccgtattgcgctacaaccccaaaacgggctacggcgcgattgaagccgcctacacgttt
ccgattaagggcaaactcaaaggcgtggtacgcggattccacggttacggcgagagcctg
atcgactacaaccacaagcagaacggtatcggtatcgggttgatgttcaacgacttggac
ggcatctga

DBGET integrated database retrieval system