KEGG   Nocardia nova: NONO_c19950Help
Entry
NONO_c19950       CDS       T03032                                 

Definition
putative glycogen synthase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
nno  Nocardia nova
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NONO_c19950
Enzymes [BR:nno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NONO_c19950
Glycosyltransferases [BR:nno01003]
 Polysaccharide
  Storage polysaccharide
   NONO_c19950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2184341..2185603
Genome map
AA seq 420 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLAVELAAAGHEVVVLARRPMGTDATTHPTHTFIEDR
VLVVAVAEDPPAFDFGEDMLAWTLAMGHAMVRAGIALSKPGIADGWTPDVVHAHDWLVAH
SAIALAEHYDVPLVSTIHATEAGRHSGWVSGRVNRQVHSVEWWLARESDALITCSASMQD
EVDSLYGPGLVPVTVIRNGIDVGAWTFRDRAPRSGPPRLLYVGRLEYEKGIQDAIAALPR
IRRAHPGTTLTIAGVGTQFEWLRERARVHRVARAVNFAGRLDHTELLGWLHGADAIVLPS
RYEPFGIVALEAAAAGTPLVTSTAGGLGELVVDGVTGASFEPADVTGLVEAVTAVLDDPV
AAQQRAYAAHARLTADFAWDVVAAETIQVYQAAKRRVRNPLGRPVITERPLPERDPNNPL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttgatggtgtcgtgggagtacccaccggtggtagtcggcgggctcggtcgc
cacgtccatcatctggcggtcgaactggccgccgccggacacgaggtcgtcgtgctggcc
cgccgtccgatgggcaccgacgcgaccacccatcccacccacacgttcatcgaggaccgg
gtgctggtggtcgcggtcgccgaggatccgcccgccttcgatttcggcgaggacatgctc
gcctggacgctggccatggggcacgcgatggtgcgggccggtatcgcgctgagcaaaccc
ggaatcgccgacggctggaccccggacgtggtgcacgcccacgactggctggtcgcgcat
tcggcgatcgcgctggccgagcactacgacgtgccgctggtctcgaccatccacgccacc
gaggccgggcggcacagcggctgggtgtccggccgggtcaacaggcaggtccattcggtg
gagtggtggctcgcccgcgaatccgacgcgctgatcacctgttcggcgtcgatgcaggac
gaggtggacagcctctacggtcccggactggtgccggtgaccgtgatccgcaacggaatc
gacgtgggggcgtggacatttcgcgaccgcgcaccgcgctcggggccaccgcggctgctg
tacgtcggacggctcgaatacgagaagggcatccaggacgcgatcgccgcgctgccgcgg
atccgccgggcgcatccgggcaccacactcaccatcgccggggtcggcacccagttcgag
tggttgcgcgagcgcgcccgggtgcaccgggtggcacgggcggtgaatttcgccgggcgc
ctggaccatacggaactgctgggctggctgcacggcgccgacgcgatcgtgctgccgagc
cgctacgaaccgttcggcatcgtcgcgctcgaggccgccgcggccggtacgccgctggtc
acctcgaccgccggtgggctgggtgagctggtggtcgacggcgtcaccggcgcctccttc
gaacccgcggacgtgaccggactggtcgaggcggtgaccgcggtgctcgacgatccggtg
gccgcccagcagcgcgcctacgccgcacacgcgcgactgaccgccgatttcgcctgggat
gtggtggcggcggagacgatccaggtctatcaggccgccaagcgccgggtccgcaacccg
ctgggccgcccggtgatcaccgaacgcccgctgccggaacgggatccgaacaacccgctg
taa

DBGET integrated database retrieval system