KEGG   Nocardia nova: NONO_c32030Help
Entry
NONO_c32030       CDS       T03032                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nno  Nocardia nova
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NONO_c32030
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NONO_c32030
Enzymes [BR:nno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NONO_c32030
Lipid biosynthesis proteins [BR:nno01004]
 Desaturase
  First
   NONO_c32030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(3492743..3493711)
Genome map
AA seq 322 aa AA seqDB search
MTDIPATAPHTSKLTVGNAYIHRLQRRHFLLFDVAPFLGVIAAIAFAWVRPPGFPEFGAL
AIMWSLTGIGVTVGYHRLFTHRSFHAAQPVALTLAVLGSMAGQGGVVSWVAIHRRHHECS
DRDGDPHSPNLSGGGLAGRVRGLAHSHFLWMRRHEYPNIVHYAPDLLKNRPLVRVARWYY
HWFALGMLAPGVVCGLITLSWQGFVGGVLWGGLVRVFVLEHIVWAINSLLHMFGTRPYRS
RENSRNGGVFALISLGESWHNNHHAFPESPSFGLDWYRLDPGYWVIRLLALAGLARDLKL
PTPARRNAKRAQPRPNAVETTT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacattcccgcaaccgcaccgcacacgagcaagctgaccgtcggcaatgcctac
atccatcgcctgcagcgcaggcatttcctgctgttcgacgtggcgccgttcctcggcgtg
atcgcggcgatcgcgttcgcgtgggtgcgcccgcccggcttcccggaattcggggcgctg
gcgatcatgtggtcgctgaccggaatcggcgtcaccgtcggctatcaccggctgttcacc
caccgcagcttccacgcggcgcaaccggtggcgctcacgctggcggtcctcggttcgatg
gccggacagggcggtgtggtgtcctgggtggccatccatcgccgccatcacgaatgcagc
gaccgggacggtgatccgcactcccccaatctgtccggcggcggcctcgcgggccgggtg
cgcggcctggcgcattcgcacttcctgtggatgcgccgccacgaatatccgaacatcgtc
cactacgcaccggatctgctgaagaaccgtccgctcgtacgggtggcccggtggtactac
cactggttcgcgctgggcatgctggcgccgggcgtggtgtgcggcctgatcacgctgagc
tggcagggtttcgtcggcggggtgctgtggggcgggctggtgcgggtcttcgtcctcgag
cacatcgtgtgggcgatcaactcactgctgcacatgttcggcacccgcccgtaccggtcg
cgggagaacagccgcaacggcggcgtcttcgcgctgatctcgctgggcgagtcctggcac
aacaaccatcacgccttcccggagtcgccgtcgttcggattggactggtaccggctcgat
cccggctactgggtgatccggctgctggccctggccgggctggcccgggatctgaaactg
ccgacgcccgcgcgccggaacgcgaaacgcgcgcagccgcgcccgaacgctgtcgaaacc
acgacatag

DBGET integrated database retrieval system