KEGG   Nocardia nova: NONO_c33470Help
Entry
NONO_c33470       CDS       T03032                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nno  Nocardia nova
Pathway
nno00071  Fatty acid degradation
nno00072  Synthesis and degradation of ketone bodies
nno00280  Valine, leucine and isoleucine degradation
nno00310  Lysine degradation
nno00362  Benzoate degradation
nno00380  Tryptophan metabolism
nno00620  Pyruvate metabolism
nno00630  Glyoxylate and dicarboxylate metabolism
nno00640  Propanoate metabolism
nno00650  Butanoate metabolism
nno00900  Terpenoid backbone biosynthesis
nno01100  Metabolic pathways
nno01110  Biosynthesis of secondary metabolites
nno01120  Microbial metabolism in diverse environments
nno01130  Biosynthesis of antibiotics
nno01200  Carbon metabolism
nno01212  Fatty acid metabolism
nno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NONO_c33470
   00630 Glyoxylate and dicarboxylate metabolism
    NONO_c33470
   00640 Propanoate metabolism
    NONO_c33470
   00650 Butanoate metabolism
    NONO_c33470
  Lipid metabolism
   00071 Fatty acid degradation
    NONO_c33470
   00072 Synthesis and degradation of ketone bodies
    NONO_c33470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NONO_c33470
   00310 Lysine degradation
    NONO_c33470
   00380 Tryptophan metabolism
    NONO_c33470
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NONO_c33470
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NONO_c33470
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NONO_c33470
Enzymes [BR:nno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NONO_c33470
Exosome [BR:nno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NONO_c33470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHH18134
UniProt: W5TG39
Position
complement(3643048..3644259)
Genome map
AA seq 403 aa AA seqDB search
MRDVVICEPVRTPIGRYGGVLAALTAAELGVVALRGLLERTGISPDLIEDVILGNCNPNS
EAPALGRVVALDAGLPVTVGGMQLDRRCGSGLQSVIQAVLQVGSGANEIVVAGGAESMSN
VPFYSTDIRWGAARTGVTMHDGLVRARETAGGKFHPVPGGMLETAENLRREYDIPREEQD
RLALRSHRRAIAAIEDGAAAQQIVPTPVRTRRAEQIVDTDEHPRADTTLESLAALTPVRA
AIDPESTVTAGNSSGQNDAAALCLVTTRDTAADLGLTPLVRLRSWAVAGVDPALMGIGPV
PATAAALARAGLDLADIDLIELNEAFAAQALAVLREWKFGESDLDRVNVHGSGISLGHPV
GATGTRMLATLARELHRRDLRYGLETMCIGGGQGLAAVFEKVD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgtcgtcatctgcgaacccgtccggacgccgatcggacgctacggcggcgtg
ctggccgcgctcaccgcggccgaactcggcgtcgtcgcgctgcgtggcctgctggagcgc
accggcatctcgcccgacctgatcgaagacgtgatcctcggcaactgcaaccccaacagc
gaggcgccggccctcgggcgggtggtcgcactcgacgccggactgccggtgaccgtgggc
gggatgcaactggaccgccgctgcgggtccgggttgcagtcggtgatccaggccgtgctg
caggtcggcagcggcgccaacgagatcgtcgtcgcgggcggcgcggagagcatgagcaac
gttcccttctactcgaccgatatccgctggggcgcagcgcgaaccggcgtcacgatgcac
gacggtctggtccgggccagggagaccgcgggcgggaagttccacccggttcccggcggg
atgctcgagaccgccgagaatctgcggcgcgaatacgacattccgcgcgaggagcaggac
cggctcgccctgcgctcccatcggcgggcgatcgcggccatcgaggacggcgccgcggcc
cagcagatcgtgccgacgccggtgcgcacccgtcgtgccgagcagatcgtggacaccgac
gagcacccgcgcgccgacaccaccctggagtcgctggccgcgctcaccccggtccgagcg
gcgatcgaccccgaatcgaccgtcaccgcgggcaattcgagcggccagaacgacgcggcc
gcgctctgcctggtcaccacccgcgacaccgccgccgacctcggactgacgccgctggtg
cggttgcggtcctgggcggtcgccggggtggaccccgcgctcatgggtatcggcccggta
cccgccacggccgccgcgctcgcgcgcgccggactcgacctcgccgatatcgacctgatc
gagctgaacgaggccttcgccgcccaggcgctggccgtgctgcgcgagtggaaattcggt
gaatccgacctggaccgcgtgaacgtgcacggctccgggatctcgctgggacatcccgtc
ggcgccaccggcacccggatgctggccaccctcgctcgcgaactccaccgccgggacctg
cgctacggcctcgagacgatgtgcatcggcggcgggcaggggctggcggccgtcttcgaa
aaagtggactga

DBGET integrated database retrieval system