KEGG   Nocardia nova: NONO_c53380Help
Entry
NONO_c53380       CDS       T03032                                 

Gene name
ppc
Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nno  Nocardia nova
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NONO_c53380 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NONO_c53380 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NONO_c53380 (ppc)
   00680 Methane metabolism
    NONO_c53380 (ppc)
Enzymes [BR:nno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NONO_c53380 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(5828733..5831537)
Genome map
AA seq 934 aa AA seqDB search
MVDTDGMREDQIESATAPLRDDIRFLGAILGETIRDHEGAEVFDLIERVRVEAFRVRRSE
VERSAVAEMLRDTDLRVAIPLIRAFSHFLLLANLAEDLQRDRRRAVHVGAGEPPQESSLA
ATYAALDRARIDGAVAAEVLADALVSPVITAHPTETRRRTVFDVQARITELMRQRARYRD
DEPDYAAIDHDIRRQILTLWRTALIRLARLRISDEIEVGLRYYELTLLEVIPRINAEVRA
ALRAHWPGYELLARPILRPGSWIGGDRDGNPNVTGEVVERATRRAGSVIFAHYMKELVAL
EKSLSQSIRLVDITPELARLADAAGDDSAQRADEPYRRAIRGIRLRTAATASRALGSAAE
LPSVFELGGDRVDTVAPYENPVQLLTELDIVDSSMRASGDALLADDRLAALRGAVETFGF
HLQGLDMRQNSEVHEQVVAELLAWSGVHSGYRDLTESERVDLLSRELSTRRPLLGPNARL
SDLAAKELGVLRAARSALDTLGPDTVPNYIISMCTSVSDMLEAALLLKEAGILDPGDENT
PPRSPVGVVPLFETIDDLRGGAATLAAALDVPVYRRLVAARAMAQEVMLGYSDSNKDGGY
LAANWALYRAELDLVETARKTGIRLRLFHGRGGTVGRGGGRSYDAILAQPAGAVRGSLRL
TEQGEVISTKYAESGSAHRNLESLVAGTLESSLLDVEGLGDGAEAAYEIFEELAEAARRS
YARLVHETPGFVDYFRASTPIAEVADLNLGSRPASRKPTNSVSDLRAIPWVMAWSQSRVM
LPGWYGTGSAIQEWAGTDQERWQTLRDLYRRWPFFRTVMSNLAQVMAKADMDIAESYAEL
VGDTSLRTTIFGMIREEFDRTADVHAAITGSAELLSDNPALAESIRNRFPYLEPLNQMQV
GLLRRRRAGDDSELVERGILLTMNGLATALRNSG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatactgacggtatgcgcgaagatcagatcgagagcgctacggcgcccctgcgg
gacgatatccggtttctcggcgcgattctgggcgagacgattcgcgatcacgagggtgcg
gaggtgttcgacctcatcgaaagagtccgggtcgaggcctttcgcgtgcgccgctcggaa
gtggagcgcagtgccgtcgcggagatgctgcgcgataccgatctgcgggtcgcgatcccg
ttgatccgggcgttcagccatttcctgctgctggcgaatctggccgaggacctgcagcgc
gatcgccgccgggcggtccacgtcggcgccggtgagccgccgcaggaatcgagcctggcc
gccacctacgctgccctcgaccgtgcccggatcgacggtgcggtcgccgccgaggtactc
gccgacgccctggtctcgccggtgatcaccgcacatcccaccgagacccgccgccggacc
gtcttcgatgtgcaggcccgcatcaccgaactgatgcgccagcgcgcccgctatcgcgac
gacgaacccgattacgcggccatcgaccacgacatccgacgtcagatcctgacactctgg
cgcaccgcgctgatccggctggcgcgcctgcggatctccgacgagatcgaggtcggactg
cggtactacgagttgacgctgctcgaggtgatcccgcggatcaatgccgaggtgcgggcc
gcgctgcgggcacactggcccggatacgaactgctggcccgcccgatcctgcgtcccggt
tcgtggatcggcggcgatcgtgacggtaatccgaacgtcaccggtgaggtggtggagcga
gcgacccgccgggcgggttcggtgatcttcgcgcactatatgaaagagcttgtcgcgctg
gagaaatcgctgtcgcagtcgattcggctggtggacatcacgcccgagctggcgcggctg
gccgacgccgccggggacgattccgcgcagcgggccgacgagccctaccgccgcgcgatc
aggggtatccggttgcgtaccgccgccaccgcgagtcgcgcgctggggtcggctgccgaa
ctgccgtcggtgttcgaactcggcggtgaccgggtggacaccgtcgcgccctacgagaac
ccggtgcagttgctcaccgaactggacatcgtcgactcgtccatgcgcgcctccggtgac
gcgctgctggccgacgatcggctcgcggcgctgcgcggtgcggtggagaccttcggattc
cacctgcagggcctggacatgcggcagaactcggaggtgcacgagcaggtcgtcgccgag
ttgctggcctggtcgggagtgcattcgggatatcgcgacctgaccgaatccgagcgcgtc
gacctgctgtcgcgcgaattgagcacccggcgcccgctgctgggtccgaacgcgcgattg
agcgatctggcggcgaaggaactcggcgtcctgcgcgccgcccggtccgcgctggacact
ctcgggcccgacaccgtgccgaactacatcatcagtatgtgcacctcggtcagcgatatg
ctcgaggccgccctcctgctgaaggaagcgggcattctcgatccgggcgacgagaacacc
ccgccccggtccccggtcggcgtggttcccctgttcgagaccatcgacgatctgcgcggc
ggtgcggcgactctcgccgcggccctggacgttccggtctaccgccgtctcgtcgccgcc
cgcgccatggcgcaggaggtcatgctcggctactccgattcgaacaaggacggcggatat
ctggcggcgaactgggcgctgtaccgggcggagctggatctcgtcgagaccgcgcggaaa
accggaattcgcctgcggctgttccacggtcgcggtggcaccgtcgggcgcgggggcggc
cgcagctacgatgccatcctcgcccagcccgccggtgcggtccgcggctcgctgcggctc
accgaacagggcgaggtgatctccaccaaatacgccgaatccggttccgcgcaccgcaat
ctggaatccctggtggccgggacgctggagtcctcgctgctggatgtggaaggtctgggc
gacggcgccgaagcggcctacgagatcttcgaggaactggccgaggcggcccgccggtcc
tatgcccggctggtgcacgagactcccggattcgtcgactatttccgtgcgtccacgccg
atcgcggaggtcgccgacctgaatctcggaagccgcccggcctcgcgcaaacccaccaac
tccgtgtccgacctgcgggcgatcccgtgggtgatggcgtggagtcagtcgcgggtgatg
ctgcccggctggtacggcaccggcagcgcgatccaggaatgggcgggtacggatcaggag
cgctggcagacactgcgcgacctgtaccggcgctggccgttcttccgcaccgtgatgtcg
aatctggcgcaggtgatggcgaaggcggatatggacattgccgagagctacgccgaactc
gtcggcgatacgtcgttgcgtaccaccatcttcgggatgatccgggaggaattcgaccgg
accgccgatgtgcacgcggcgatcacgggcagtgccgaactcctgtccgacaacccggct
ctcgccgaatccatccgcaatcgtttcccgtatctcgagccgctcaatcagatgcaggtg
ggcctgctgcggcgccgccgtgcgggagatgattcggaactggtcgaacgcggcattctg
ctgaccatgaacggcctcgcgaccgccttgcgtaattccggttag

DBGET integrated database retrieval system