KEGG   Nocardia nova: NONO_c54840Help
Entry
NONO_c54840       CDS       T03032                                 

Definition
putative 4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nno  Nocardia nova
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NONO_c54840
   00650 Butanoate metabolism
    NONO_c54840
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NONO_c54840
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NONO_c54840
Enzymes [BR:nno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NONO_c54840
Amino acid related enzymes [BR:nno01007]
 Aminotransferase (transaminase)
  Class III
   NONO_c54840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5987784..5989025
Genome map
AA seq 413 aa AA seqDB search
MTALSPVLKQATPVVVDHGEGCYLYDTDGRRYLDFTAGIGVTSTGHCHPRVVEAAREQIG
SLIHGQYTTVMHKPLLRLTERLADVLPSHLDSLFFANSGSEAVEAALRLSRQATGRPNVV
VFHGGFHGRTVATASMTTSGTRFSAGFSPLMSGVHVAPFPTAYRYGWSEEQATDFALREL
DYILTTLTAPNETAAFIVEPVLGEGGYIPGNTRFFQGLRERADRHGILLVLDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAAPRELMAKAWPGSQGGTYGGNAVACAA
AVATIDVIESEGLVDNAAARGEQLLAGARTAATKPVGDVRGLGLLVGSEFTTATGEPDTA
TAAAAQQLAAKHGLLLLTCGAYSNVVRMIPPLIVTSEQIDEALAVWGRVLDEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactgcactttcccccgttctgaagcaggccacgccggtcgtcgtcgatcatggtgaa
ggctgctatctgtacgacaccgacggtcgccgctatctggatttcacggccggaatcggc
gtcaccagcaccgggcactgccacccgcgcgtggtcgaggccgcgcgcgaacagatcggc
agcctgatccacggccagtacacgaccgtgatgcacaagccactgctgcgcctgaccgaa
cgcctcgccgatgtgctgccgtcgcatctggattcgctgttcttcgccaactccggcagt
gaggccgtcgaagcggcgctgcggctgtcccgccaggccaccggacgacccaatgtcgtg
gtgttccacggcggattccacggccgcaccgtcgcgaccgccagcatgaccacctccggc
acccgcttctcggccggattcagcccgctgatgagcggcgtgcacgtggcccccttcccc
accgcctaccgctacggctggtcggaggaacaggccaccgacttcgcactgcgcgaactc
gactacatcctgaccacgctcacggcgccgaacgagacggccgcgttcatcgtcgagccg
gtcctgggcgagggcggctacatcccgggcaacacccggttcttccaggggctgcgcgag
cgggccgaccggcacggcatcctgctggtgctcgacgagatccagaccggattcggccgc
accggaaagttcttcggccatcagcacttcgatgtgcgaccggacatcatcaccatcgcg
aagggtctggccagcggcttcccgctgtcgggtatcgcggcgccgcgcgagctgatggcg
aaggcgtggcccggctcccagggcggaacctacggcgggaacgcggtggcgtgcgcggcc
gcggtggcgaccatcgatgtcatcgaatccgagggactggtggacaacgccgccgcccgc
ggcgagcagttgctcgccggggcccgcaccgccgccaccaagccggtcggcgacgtacgc
gggctcggactgctcgtcggcagcgaattcaccaccgcgacaggcgaacccgacaccgcc
accgcggctgcggcacagcagctggccgcgaaacacggcctgctcctgctgacctgcggc
gcctacagcaatgtcgtgcgcatgatcccgccgctgatcgtgacctccgagcagatcgac
gaggcgctggccgtctgggggcgcgtcctcgacgaactgtag

DBGET integrated database retrieval system