KEGG   Nocardia nova: NONO_c58730Help
Entry
NONO_c58730       CDS       T03032                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nno  Nocardia nova
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nno00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NONO_c58730
Enzymes [BR:nno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NONO_c58730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
6391106..6391996
Genome map
AA seq 296 aa AA seqDB search
MARIAVVGSINMDLVTRTARRPEPGETVLGTSFEQVPGGKGANQAIAAGRAGARVDFIGA
IGTDTFGTSLRKVLSDNDIGTTGLRALEGSSGIATIVVDASGENSIIVVGGTNAALTELT
AADLTIIAEADILLCQLEIPIDTVAAAARHAREHGTLVLLNPSPARRLAASIWSAVDIAV
VNEGEAAQLDSELREVPHVLVTRGGAGATYRGPEGEFHHPGVAAEVVDTTGAGDTFTGAL
AAHWHKGPRTALAWACTAGALATTAYGATAAIPTAADIARVLRDHGEPDATSTANG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgaatcgcggtggtgggcagtatcaatatggatctggtgacccgtacggcgcgg
cggccggagcccggcgagacggtgctgggcacctccttcgaacaggtgcccggcgggaag
ggcgccaatcaggcgatcgcggcgggccgggcgggtgcgcgggtcgatttcatcggcgcg
atcggtaccgacacattcggtacgtcactgcgtaaggtgctgtccgacaatgacatcggc
actacggggttgcgcgcgctcgaaggctccagcggtatcgcgacgatcgtcgtcgacgca
tcgggagagaactcgatcatcgtggtcgggggcaccaacgcggcgctgaccgaactcacc
gccgcggatctgacgatcatcgccgaggccgatattctgctgtgccagttggagataccg
atcgacaccgtggccgcggcggcccggcacgcgcgcgaacacggcaccctggtcctgctc
aatccctcacccgcgcggcgactcgcggcgagcatctggtccgcggtcgatatcgccgtg
gtcaacgaaggcgaagcggcacaactggattccgagctgcgagaggttccccacgtgctg
gtcacccgcggcggggcgggtgcgacgtatcgcgggcccgagggcgaattccaccatccc
ggcgtcgcggccgaggtggtcgacaccaccggcgccggagacaccttcaccggcgccctc
gccgcacactggcacaaaggtccccgaaccgcgctggcctgggcctgcaccgcgggagcg
ctggcgaccaccgcgtacggagcgaccgccgccatcccgacggcggcggacatcgctcgc
gtcctgcgcgatcacggagagccggacgctacctcgactgcgaacggctga

DBGET integrated database retrieval system