KEGG   Nelumbo nucifera (sacred lotus): 104598711Help
Entry
104598711         CDS       T04131                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104598711
   00500 Starch and sucrose metabolism
    104598711
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104598711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 676 aa AA seqDB search
MYTDPFRICPDLERAVSYPYNPLHNEVEQEGTPVPGRRPIKVISSILLSGIFVLALVMVF
LCVQRSQEPLTDVMERNHHHSLPSSTPVGVSRGVLEGVSEKTFRLYSNKGGVTYPWTQPM
LSWQRTAYHFQPEKNWMNDPNAPMYYNGWYHLFYQYNPESAVWGNITWGHAISKDLINWE
NLPFAMVPDEWYDINGVWTGSATLLPDGSIVVLYTGFTKDKVQVQNLAYPADPSDPRLIH
WVKYPGNPILVPPPHIRDLDFRDPTTAWFGPDGHWRVAIGSKINDTGISLVYHTTNFTTY
ELLDGLLHAVPETGMWECVDFYPVSTTEKKGLNTSDNWPGVKHVLKASLDNTKIDYYALG
TYYVENDTWIPDNEMADVGFGLRYDYGKYYASKTFYDQNKQRRVLWGWIGESDSEDDDIK
KGWASVQSIPRVVLFDQKTRSNLLQWPVEEVENLRSNLKEFNKVVVGPGTVVPLDVGTAT
QLDISAEFEIDGKALKGATRDDIVGYNCVVGGGAAGRGTLGPFGILVLAEDSLAEQTPVY
FYISKDSGGEYRTFFCADQSRSSLAPHVGKFVSGSLVPVLEGEKLTMRILVDHSIVESFG
QGGRTVITSRIYPTKAIYESARVFLFNNATEANVTASLKIWQMNSAAFINSPPPLVSIFI
ISFFYILQLGQFPFLF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtataccgatcccttccggatctgtcccgacctcgaacgtgctgtctcatacccttac
aaccctctgcacaatgaagttgaacaagagggaactccggtgcctggccggagaccgata
aaagtgatatcatctatattgttgagtggaatctttgttttagctttggtaatggtgttt
ctctgtgttcaaagatcacaagagccattaacagatgtaatggaaaggaatcatcatcac
tcacttccatcttctacacctgtgggggtatcacgtggggtattggaaggggtgtcggag
aagactttccgtctctattctaacaaaggaggagtcacgtatccatggacccaacccatg
ttgtcttggcagagaacggcttaccattttcaacccgaaaagaactggatgaatgatcct
aatgcgccaatgtattacaatggatggtaccacctattctaccaatacaaccctgagagt
gcagtgtggggcaacataacgtggggccatgccatctcaaaggacctcatcaactgggag
aatcttccttttgccatggtccctgatgaatggtacgatatcaacggtgtctggaccggt
tcggccacgctgctccccgatggttctatcgtcgtcctttataccggcttcaccaaagac
aaggttcaggtccagaacctggcctacccggccgacccctcagatcctcgtctcatccac
tgggttaagtatcccggcaatccgatcctggttccaccgccccatattcgcgacttggac
ttccgagatcccaccaccgcctggttcggtcccgacggccattggcgcgttgctatcggc
tccaagatcaacgataccggcatttctctagtgtatcataccaccaacttcaccacctac
gagcttttggatggactgctccatgccgttcccgaaaccggaatgtgggaatgcgtggac
ttctatcctgtctcaaccacggaaaagaaaggcctgaacacgtcggacaattggcctgga
gtgaagcatgtgctcaaggccagcctcgacaacactaagatagattactacgcgctcgga
acttactacgtagagaatgatacatggatcccagacaatgaaatggcggatgtgggattt
gggttgcgctatgattatggtaagtattatgcttccaagacattctacgatcaaaacaag
cagagaagagtgttgtggggttggattggtgagagcgacagcgaggacgacgacataaag
aagggctgggcatcagttcagagcattccaagggtggtgctgtttgaccagaagactagg
agcaatctacttcaatggccagtggaggaggtggagaacttgagatcgaatcttaaggaa
tttaacaaagtggtagtcggacctggaacagtcgtgccactcgacgtcggcacagcgaca
cagttggacataagtgccgagtttgagatagacggtaaggcattaaaaggggccaccaga
gatgacattgttggttacaactgcgtcgtgggtggtggagctgccggaagaggcaccttg
ggacccttcggcatcttggttctggcagaggacagcctagccgagcaaacacctgtatac
ttctacatttccaaggacagtggtggtgaatataggaccttcttctgtgccgaccaatca
aggtcttctctggcccctcatgttggtaaatttgtctccggcagcttggttcctgtactt
gaaggcgaaaagttaaccatgaggatactagttgatcattcgatagtggaaagctttggc
caaggtgggaggactgtcatcacatcaaggatatacccaacaaaagcaatatacgagtca
gctcgggttttcttgttcaacaatgctacagaggccaacgtcactgcgtcactcaagatt
tggcagatgaactctgctgctttcataaattcccccccaccccttgtatccattttcatt
atttcattcttttatattttgcagttgggccaatttccgtttttgttctag

DBGET integrated database retrieval system