KEGG   Nitrosococcus oceani: Noc_0038Help
Entry
Noc_0038          CDS       T00281                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
noc  Nitrosococcus oceani
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:noc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(37544..38032)
Genome map
AA seq 162 aa AA seqDB search
MARAYISIGSNINRENNIRAGVNALRCSYGPLIISRVFESEAVGFQGDNFYNLVVGFDTD
EAPRIITRALHEIEHACGRKRDGPRFGPRALDLDLLLYDNLVIDEPGLQVPRDDTLDYAF
VLQPLAEIAPHLPHPVLSKRYADLWAAFDKPLNRLWPVELEL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcatatatcagcattggcagcaatatcaaccgagagaataatattcgtgct
ggagtcaatgcgctgcgctgcagctatggaccccttatcatttcacgggtatttgaaagc
gaggcggtgggatttcaaggcgataatttttacaatttagtcgttggattcgatacagat
gaagcgcctcgaattatcacccgtgcgctccacgagattgaacatgcctgtggccgcaaa
cgcgacggtccccgctttggtccacgggctctcgatctggatcttctgctttatgataac
ttagtgattgatgagccgggtctccaagtaccacgggatgatacacttgattatgccttt
gtcctacaaccccttgcagaaattgcgccccacttacctcaccccgtgctaagcaaacgt
tatgctgatctctgggctgcgttcgataaacctttaaaccgtttatggccagttgagtta
gagctataa

DBGET integrated database retrieval system