KEGG   Nitrosococcus oceani: Noc_0112Help
Entry
Noc_0112          CDS       T00281                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
noc  Nitrosococcus oceani
Pathway
noc00020  Citrate cycle (TCA cycle)
noc00310  Lysine degradation
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_0112
  Amino acid metabolism
   00310 Lysine degradation
    Noc_0112
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Noc_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABA56645
JGI: Noc0112
UniProt: Q3JEV1
Position
116282..117589
Genome map
AA seq 435 aa AA seqDB search
MGTEVRVPRLPESVTEAVVGDWHKKPGDRVQRDETLLDLETDKVVLDVPSPGAGVLREVK
KEKGATVGSEEVLGIIEAAGEAEEETAQESSPKSTPSKQAPESKTQATEKKKTRADSPET
AFPSKETEAEKMPPLSPAVRRLVREHQLDPRGIPATGRDGRLTKADVVQFLQAEEEQEPA
ATPPPTEPEAPETKPAPAPREEGYGVRREAMSRLRQRIAERMLESQQTTATLSTFNEVNM
QGIMELRHRYRDAFEERYGVRLGFMSFFIKACIEAFKRYPVVNAAVQDDDILYYHYYHIG
IAVATPRGLVVPVLRDADQLSFADIELQIMDFAERARSGRLTIEELSGGTFTITNGGVFG
SLLSTPILNPPQSAILGMHKIEDRPVAENGEVKIRPMMYVALSYDHRLIDGKGAVQFLVA
VKEALEDPVRLLLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggggacagaggtgcgcgtacccagattacccgaatcggtgactgaagcagtcgtaggg
gattggcataaaaagcctggtgaccgcgtccagcgggatgaaactttgctggaccttgag
accgacaaagtagtgctggatgtcccttctcccggcgctggagttttgcgggaagtaaaa
aaggagaagggcgctaccgtaggcagcgaagaggtgcttggaataattgaggccgccggg
gaagcggaggaagaaactgcacaggaatcttccccgaagtcgacgccttccaagcaagcc
ccggagagtaaaacgcaggctacggaaaaaaagaaaacaagggctgattccccagagacg
gcgttcccttctaaagagactgaggcggagaaaatgccgcccttaagccctgcggttcgc
cgcttggttagggagcatcagctcgatccgcgggggattcctgccaccggtagagatggc
cgtttgactaaggccgatgtggttcagtttctccaagcggaagaagagcaagagccggcg
gctacgcctccccccaccgaacccgaggcacccgagacaaaaccggctccagcaccgaga
gaagaaggttatggcgttcggcgagaggccatgagccggttgcggcaacggattgccgag
cggatgctggaatctcagcagactacggctaccttgtctacctttaacgaggtgaacatg
caagggataatggaactgcgccaccgttatcgggatgcttttgaagagcggtatggggta
cgactgggttttatgtccttttttattaaggcctgtatcgaagctttcaaacgttacccc
gtagtgaacgccgctgtccaggacgatgatattttatattaccattattaccatatcggt
attgcggtggcgacgccccgcggtttagtggttcccgtgctgcgggatgcggatcagctc
agtttcgctgatatcgaactccaaatcatggattttgccgagcgggcgcgcagtggacgg
ctcacgattgaggagttgagcggtggcactttcaccattactaatggtggggtatttggt
tccctgctctccactcctatcctgaacccgccccaaagcgctattcttgggatgcacaag
attgaagatcggccagtagcggaaaatggcgaggttaaaatccgtccgatgatgtacgtg
gcgctctcctatgatcatcgccttattgatggcaagggagccgttcaatttttagtggca
gtcaaagaggctctagaagatcctgtgcggttattgcttgaggtgtga

DBGET integrated database retrieval system