KEGG   Nitrosococcus oceani: Noc_0112Help
Entry
Noc_0112          CDS       T00281                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
noc  Nitrosococcus oceani
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noc_0112
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_0112
  Amino acid metabolism
   00310 Lysine degradation
    Noc_0112
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Noc_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
116282..117589
Genome map
AA seq 435 aa AA seqDB search
MGTEVRVPRLPESVTEAVVGDWHKKPGDRVQRDETLLDLETDKVVLDVPSPGAGVLREVK
KEKGATVGSEEVLGIIEAAGEAEEETAQESSPKSTPSKQAPESKTQATEKKKTRADSPET
AFPSKETEAEKMPPLSPAVRRLVREHQLDPRGIPATGRDGRLTKADVVQFLQAEEEQEPA
ATPPPTEPEAPETKPAPAPREEGYGVRREAMSRLRQRIAERMLESQQTTATLSTFNEVNM
QGIMELRHRYRDAFEERYGVRLGFMSFFIKACIEAFKRYPVVNAAVQDDDILYYHYYHIG
IAVATPRGLVVPVLRDADQLSFADIELQIMDFAERARSGRLTIEELSGGTFTITNGGVFG
SLLSTPILNPPQSAILGMHKIEDRPVAENGEVKIRPMMYVALSYDHRLIDGKGAVQFLVA
VKEALEDPVRLLLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggggacagaggtgcgcgtacccagattacccgaatcggtgactgaagcagtcgtaggg
gattggcataaaaagcctggtgaccgcgtccagcgggatgaaactttgctggaccttgag
accgacaaagtagtgctggatgtcccttctcccggcgctggagttttgcgggaagtaaaa
aaggagaagggcgctaccgtaggcagcgaagaggtgcttggaataattgaggccgccggg
gaagcggaggaagaaactgcacaggaatcttccccgaagtcgacgccttccaagcaagcc
ccggagagtaaaacgcaggctacggaaaaaaagaaaacaagggctgattccccagagacg
gcgttcccttctaaagagactgaggcggagaaaatgccgcccttaagccctgcggttcgc
cgcttggttagggagcatcagctcgatccgcgggggattcctgccaccggtagagatggc
cgtttgactaaggccgatgtggttcagtttctccaagcggaagaagagcaagagccggcg
gctacgcctccccccaccgaacccgaggcacccgagacaaaaccggctccagcaccgaga
gaagaaggttatggcgttcggcgagaggccatgagccggttgcggcaacggattgccgag
cggatgctggaatctcagcagactacggctaccttgtctacctttaacgaggtgaacatg
caagggataatggaactgcgccaccgttatcgggatgcttttgaagagcggtatggggta
cgactgggttttatgtccttttttattaaggcctgtatcgaagctttcaaacgttacccc
gtagtgaacgccgctgtccaggacgatgatattttatattaccattattaccatatcggt
attgcggtggcgacgccccgcggtttagtggttcccgtgctgcgggatgcggatcagctc
agtttcgctgatatcgaactccaaatcatggattttgccgagcgggcgcgcagtggacgg
ctcacgattgaggagttgagcggtggcactttcaccattactaatggtggggtatttggt
tccctgctctccactcctatcctgaacccgccccaaagcgctattcttgggatgcacaag
attgaagatcggccagtagcggaaaatggcgaggttaaaatccgtccgatgatgtacgtg
gcgctctcctatgatcatcgccttattgatggcaagggagccgttcaatttttagtggca
gtcaaagaggctctagaagatcctgtgcggttattgcttgaggtgtga

DBGET integrated database retrieval system