KEGG   Nitrosococcus oceani: Noc_0113Help
Entry
Noc_0113          CDS       T00281                                 

Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
noc  Nitrosococcus oceani
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:noc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:noc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:noc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:noc00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:noc00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:noc00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
117611..119053
Genome map
AA seq 480 aa AA seqDB search
MSERYDVVIIGAGPAGYTAAIRCAQLGLQTACIDKWIAADGRPALGGTCLNAGCISSKAL
LDSSELYQRAQKEFAEHGIKVEQAGVDVTAMQARKDRLVHRLTANIAALFEDRQIKWLPG
HGRLLEDNRVEFTPHGLDRPEILAAKSVVLASGSQPMELGAAPIDGERVVDSTGALSFQE
VPQRLGIIGAGVIGVELGSVWTRLGAKVTLLEAQDTLLPMADITISQEAYKQFKDQGLDI
RLGARVVSTRVSSKQVTVCYRIGEKEYELEVDKLVVAVGRQPCLDNLFALEAGLLLDERG
FIHVDEYGTTNLPGVYAVGDVVRGPMLAHKGSQEGIAVAETIAEGKKTAVKRNSIPWVIY
TEPEIAWAGRTEQALRDADIDVRVGTFYFADSARANVMSGSKGLVKIIADAMTDQILGVH
IIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAEALHEAALDVDNRAIHKIGRKKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgctacgatgttgtgatcattggcgctgggccggctggttatacggcggct
atccggtgcgctcagcttggtttgcagactgcttgtatcgacaagtggatcgctgccgat
ggcagacctgctttaggaggcacctgtcttaatgcaggctgcatctcttccaaagccttg
ctggactcctcggaactttatcaacgggcgcaaaaggagtttgccgaacatggaatcaag
gtcgagcaagccggtgtggatgtgacggcgatgcaggcccgcaaggaccgtctggtgcat
cgtctcacagcaaatatcgctgcgctattcgaggaccgccagatcaaatggcttccgggg
catgggcggttattggaagataatcgggtggaattcacgccccatggattagatcgtccg
gagatactggcggcgaagagcgttgttttagccagtggttcccagcctatggaactaggc
gcggcgcccattgatggagagcgggtggtggattccacgggggccttgtcattccaggaa
gttcctcagcgtttgggaattattggtgctggagtcattggggtagagctaggcagtgtc
tggacccgtctaggggcaaaagtgactttgcttgaagctcaggatactcttttgccaatg
gcggatatcaccatttcccaagaagcttataagcaatttaaagaccaagggctggatatc
cgtttaggtgcccgcgtcgtttccacccgcgttagctcgaagcaagtgactgtatgctat
cggatcggcgaaaaggagtatgaacttgaggtggataagctggtcgtcgccgtagggcgg
cagccttgtttggataacctttttgccctggaagcgggtctgttattggatgaaaggggt
ttcatccatgtagatgagtatggtaccacgaatctccctggggtctatgcggtaggagat
gtagtgcggggtcccatgctagcccacaagggttcccaggaaggaatcgcggtggcagag
actatcgccgagggtaaaaaaaccgcggtgaaacggaatagcatcccctgggtgatctac
acagagcctgaaatcgcctgggcgggacgtaccgaacaagctttacgagatgccgatatt
gatgtgcgcgtaggcaccttctattttgccgactctgcccgtgctaacgtaatgagcggc
agcaaaggcttggtcaaaataatagcggatgccatgaccgatcagattctaggggtccac
attattggaccttgggcctcggagctgattgccgaagctgtgttggccatggaatttgct
gctagcagcgaagatttagcgcggaccattcatgcctatcccagcctggcggaagcatta
cacgaagcagccttagatgtggataatcgcgccattcataagatagggcggaaaaaagaa
taa

DBGET integrated database retrieval system