KEGG   Nitrosococcus oceani: Noc_0113Help
Entry
Noc_0113          CDS       T00281                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
noc  Nitrosococcus oceani
Pathway
noc00010  Glycolysis / Gluconeogenesis
noc00020  Citrate cycle (TCA cycle)
noc00260  Glycine, serine and threonine metabolism
noc00280  Valine, leucine and isoleucine degradation
noc00620  Pyruvate metabolism
noc00630  Glyoxylate and dicarboxylate metabolism
noc00640  Propanoate metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
noc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_0113
   00020 Citrate cycle (TCA cycle)
    Noc_0113
   00620 Pyruvate metabolism
    Noc_0113
   00630 Glyoxylate and dicarboxylate metabolism
    Noc_0113
   00640 Propanoate metabolism
    Noc_0113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_0113
   00280 Valine, leucine and isoleucine degradation
    Noc_0113
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Noc_0113
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Noc_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_binding_3 Thi4 HI0933_like NAD_binding_8 AlaDh_PNT_C FAD_oxidored DAO 3HCDH_N 2-Hacid_dh_C Lycopene_cycl Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ABA56646
JGI: Noc0113
UniProt: Q3JEV0
Position
117611..119053
Genome map
AA seq 480 aa AA seqDB search
MSERYDVVIIGAGPAGYTAAIRCAQLGLQTACIDKWIAADGRPALGGTCLNAGCISSKAL
LDSSELYQRAQKEFAEHGIKVEQAGVDVTAMQARKDRLVHRLTANIAALFEDRQIKWLPG
HGRLLEDNRVEFTPHGLDRPEILAAKSVVLASGSQPMELGAAPIDGERVVDSTGALSFQE
VPQRLGIIGAGVIGVELGSVWTRLGAKVTLLEAQDTLLPMADITISQEAYKQFKDQGLDI
RLGARVVSTRVSSKQVTVCYRIGEKEYELEVDKLVVAVGRQPCLDNLFALEAGLLLDERG
FIHVDEYGTTNLPGVYAVGDVVRGPMLAHKGSQEGIAVAETIAEGKKTAVKRNSIPWVIY
TEPEIAWAGRTEQALRDADIDVRVGTFYFADSARANVMSGSKGLVKIIADAMTDQILGVH
IIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAEALHEAALDVDNRAIHKIGRKKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgctacgatgttgtgatcattggcgctgggccggctggttatacggcggct
atccggtgcgctcagcttggtttgcagactgcttgtatcgacaagtggatcgctgccgat
ggcagacctgctttaggaggcacctgtcttaatgcaggctgcatctcttccaaagccttg
ctggactcctcggaactttatcaacgggcgcaaaaggagtttgccgaacatggaatcaag
gtcgagcaagccggtgtggatgtgacggcgatgcaggcccgcaaggaccgtctggtgcat
cgtctcacagcaaatatcgctgcgctattcgaggaccgccagatcaaatggcttccgggg
catgggcggttattggaagataatcgggtggaattcacgccccatggattagatcgtccg
gagatactggcggcgaagagcgttgttttagccagtggttcccagcctatggaactaggc
gcggcgcccattgatggagagcgggtggtggattccacgggggccttgtcattccaggaa
gttcctcagcgtttgggaattattggtgctggagtcattggggtagagctaggcagtgtc
tggacccgtctaggggcaaaagtgactttgcttgaagctcaggatactcttttgccaatg
gcggatatcaccatttcccaagaagcttataagcaatttaaagaccaagggctggatatc
cgtttaggtgcccgcgtcgtttccacccgcgttagctcgaagcaagtgactgtatgctat
cggatcggcgaaaaggagtatgaacttgaggtggataagctggtcgtcgccgtagggcgg
cagccttgtttggataacctttttgccctggaagcgggtctgttattggatgaaaggggt
ttcatccatgtagatgagtatggtaccacgaatctccctggggtctatgcggtaggagat
gtagtgcggggtcccatgctagcccacaagggttcccaggaaggaatcgcggtggcagag
actatcgccgagggtaaaaaaaccgcggtgaaacggaatagcatcccctgggtgatctac
acagagcctgaaatcgcctgggcgggacgtaccgaacaagctttacgagatgccgatatt
gatgtgcgcgtaggcaccttctattttgccgactctgcccgtgctaacgtaatgagcggc
agcaaaggcttggtcaaaataatagcggatgccatgaccgatcagattctaggggtccac
attattggaccttgggcctcggagctgattgccgaagctgtgttggccatggaatttgct
gctagcagcgaagatttagcgcggaccattcatgcctatcccagcctggcggaagcatta
cacgaagcagccttagatgtggataatcgcgccattcataagatagggcggaaaaaagaa
taa

DBGET integrated database retrieval system