KEGG   Nitrosococcus oceani: Noc_0114Help
Entry
Noc_0114          CDS       T00281                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
noc  Nitrosococcus oceani
Brite
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Noc_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(119410..120861)
Genome map
AA seq 483 aa AA seqDB search
MRKKTILPFCLLLAGIPLYAVANQEPSIPTNGPNSHGHLTLFSYLSANNLAYSGANYRLP
LPATDSDFYDHGRPDPAKFQLGKFLFFDKILSGNQNISCATCHHPLAATGDGLSLSVGEG
GRGLGITRNTGFGNEAIYERVPRNAPPLFNVGAKHMTVMFYDGRAEVDSLAPSGFNTPAG
DELPIGVLENVLAAQAMFPVTSNSEMAGQPGENPIADAAEAGNLAGPGGVWEQLANRLKA
NEEYAQLFNQAFALTPEQITYAHAANAIAAFEAAAWRADHSPFDRYLRGDKEAMSRESIQ
GMSLFYGKAGCSQCHSGVFQTDMQYHAIAMPQIGPGKGDGAEGHEDFGRERVTHDPADRY
KFRTPPLRNVALTGPWGHDGTYNTLEAVVRHHLDPVSSLLTYSCLREAQLPYREDLDFFD
CLVQNDSAKVNLIAAANTLPTRELSDDEVKHLLAFLHALTDPISLDLRGDIPDRVPSNLT
LVE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagaaaactatcttgcctttctgcttattattagcaggtatacccctctatgca
gtggccaatcaggagccatctatccctacaaacggccccaattctcacggccatttaacc
ttattttcatatttgtcagcaaataacctagcctactctggtgctaattatcgtttgcct
ctccctgcgactgactctgatttttacgatcatggtaggcctgatcctgcgaagttccag
ttaggtaaattcctttttttcgacaagatcttaagcggcaatcaaaatatctcctgcgcc
acctgccatcaccccttggctgctaccggcgatggtctttccttgtccgtgggggaaggg
ggacgaggactaggaattacccgaaatacgggtttcgggaatgaggctatttacgagcgc
gttccccggaatgcacctccgctttttaatgtaggcgccaaacacatgaccgtgatgttt
tacgatggccgggcagaagtagattccttagcacccagcgggttcaataccccggcaggg
gatgagttacctattggagttctagaaaatgtgttggctgctcaagctatgtttccagtc
acttccaattcagaaatggcagggcaaccaggggaaaatcctattgccgatgcggcagaa
gctggcaatttagcaggacccgggggtgtttgggaacagctcgcgaatcggttaaaagct
aacgaagagtatgctcaactgtttaaccaagcttttgccctgacccctgagcaaattacc
tatgctcatgccgccaacgctattgcggcttttgaggcagcggcatggcgagcggatcat
agcccttttgatcgctacctgcgcggcgataaagaggcaatgagcagagaatccattcaa
ggaatgagcctcttctatgggaaggcaggttgctctcaatgccacagcggagtttttcaa
accgatatgcaatatcatgccattgcaatgccccagattggtccgggcaaaggagatggc
gctgaaggtcatgaggattttggacgggagcgggttactcacgatcccgctgatcgctat
aagtttcgcacccccccgcttcgaaatgtggcgcttacaggcccctgggggcatgatggc
acctacaataccttggaagctgtggttcgccatcacctagatccagtgagttcccttctc
acttactcatgcctaagggaggcccaactaccttatcgtgaggatttagattttttcgat
tgcctagtacaaaacgatagcgctaaggttaacctgattgctgctgctaacacactcccc
acaagggagttaagcgatgatgaggtaaagcatctgctggcattccttcatgctttaacg
gatcctatcagtctcgatttgcgcggtgatattccagacagagtacctagcaatctgacg
cttgtggagtaa

DBGET integrated database retrieval system