KEGG   Nitrosococcus oceani: Noc_0139Help
Entry
Noc_0139          CDS       T00281                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
noc  Nitrosococcus oceani
Pathway
noc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:noc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Noc_0139
Enzymes [BR:noc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Noc_0139
DNA repair and recombination proteins [BR:noc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Noc_0139
    RecFOR pathway proteins
     Noc_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH IMS_HHH HHH_8 Transposase_20 HHH_3
Motif
Other DBs
NCBI-ProteinID: ABA56672
JGI: Noc0139
UniProt: Q3JES4
Position
151463..152062
Genome map
AA seq 199 aa AA seqDB search
MIGRLRGILLEKRAPFLLLDVQGVGYELEAPLSTFYVLPAMGAEVILYTHLVVRDDAHLL
YAFASEKERGLFRSLIRVNGVGAKLGLGILSGIEAESFTRCVQEGDTVSLTRLPGVGKKT
AERLIVEMRDRLLDMPESGVAGMRPDRVDGSAPGTVAEAVSALVALGYKPNEASRAVRRL
DTEALTTEEIIRQALQRML
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgtctgcggggtattttattggaaaaacgggctccctttttactattagat
gtacaaggtgtaggttatgagctggaagctcctttgtctacgttctatgtccttcccgct
atgggcgctgaggtgatcctatacactcatctggtggtgcgagacgatgcccacctgctg
tatgctttcgccagtgaaaaggagcgcgggctgttccggagtcttattcgggttaatggt
gtgggcgctaaattgggattgggaattctttctggaatagaggccgaatcctttacccgc
tgtgtccaggaaggagatacggtgagtctgacccggttgcctggcgtaggtaaaaaaacg
gcggaacgcctcattgtggagatgcgggatcggctgctcgatatgccggagagtggagtg
gcagggatgcgccccgatagggttgatggttccgccccggggacagtggcggaagcggtc
agcgccctggtggcgctaggttataaacctaatgaagctagccgggcggtgcgccgcctc
gatacggaggcattgaccacggaggagatcatccggcaggcgctacagcggatgttataa

DBGET integrated database retrieval system