KEGG   Nitrosococcus oceani: Noc_0271Help
Entry
Noc_0271          CDS       T00281                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
noc  Nitrosococcus oceani
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Noc_0271
Enzymes [BR:noc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Noc_0271
    3.5.1.-  
     Noc_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
299700..300365
Genome map
AA seq 221 aa AA seqDB search
MERPPVTFNKARAVLLLVDIQPDFLPGGGLPVADGSQIIEPVRLLMESDKFCHYVATQDW
HPPGHVSFASSHPGAEPMATLEINGYAQTLWPDHCIQGTSGAELHGDLPWEKVAAIIRKG
TDPESDSYSGFHNNWNSAGERPATGLAGYLRERGIEELFICGLARDVCIKWTAEDGANAG
FNVYVLWDLTRPVEPSSDDQVRRELIAHDVKIIDWEQLVRY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaccccctgttacctttaataaggcacgcgccgtattattattggtagatatt
caaccagattttctacctggaggtgggcttcctgtagcagatggcagccaaatcatcgag
ccagtgcgattgctgatggaatccgataaattttgccattatgtggcgactcaggattgg
catccacccggtcatgtctcctttgccagcagccacccaggggctgaacctatggctacc
cttgaaatcaacggttacgcccagaccctgtggcctgatcactgcatccagggaacgtca
ggcgctgaacttcatggagatctgccctgggaaaaggtggcggccatcatacgtaaggga
accgatccagagagcgattcctatagcggatttcataataactggaattccgcaggtgag
cgtcctgctaccggattagcgggttatttgcgggagcggggtatagaagaattatttatc
tgcggccttgcccgtgacgtttgcataaaatggaccgctgaagacggtgctaatgccggc
tttaatgtttacgtgctatgggatctcacccgccccgtggaaccttcttccgatgaccag
gtacgccgggagctaatagcccatgacgttaaaattattgattgggagcagcttgttagg
tattga

DBGET integrated database retrieval system