KEGG   Nitrosococcus oceani: Noc_0995Help
Entry
Noc_0995          CDS       T00281                                 

Definition
helicase RecD/TraA (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
noc  Nitrosococcus oceani
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:noc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Noc_0995
Enzymes [BR:noc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Noc_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1101776..1103959)
Genome map
AA seq 727 aa AA seqDB search
MNAFHPEASPEFLAGTIERVTFHSEETGFCVLRIKVRGEHNLVTVVGNTATVTPGEYVEC
RGEWINDRTHGLQFKAKHLKVIPPSTLEGIEKYLGSGMVRGIGPHFAKKLVQAFGEQVFE
VIEHTAERLTELDGIGPKRKARVIQSWAEQKAVRAIMVFLQSQGVGSARAVRIYKTYGDH
AIERVRENPYRLALDIHGIGFKTADRIAQRLGIPADSLIRAQAGVRHVLQEFTTEGHCAM
EQDKLVETASKLLEIPVPTIEQAIAQEVTAGQLIAEVIHDKSCLFLTPLYRSETGVAKHL
QRLLQGRPPWGEINTDKAIPWAEEKTGLRLSPSQRAAVTQAVGSKIIVISGGPGVGKTTV
VNSIIRIVQVKQIQIHLGAPTGRAAKRLAESTGFEAKTIHRLLEFNPHAIGFKHHRGNPL
HTDLVIIDEVSMVDVGLMNQLLQAIPSHAACILIGDRDQLPSVGPGQVLADIIASKKITA
VHLTEVFRQAARSKIVVNAHRINQGKMPERTHEAAPLSDFYFIPTESPETIQDRLLELVS
TRIPKRFGFDPIRDIQVLTPMNRGSLGAQALNALLQQQLNAQASPKINRFGWTFALGDKI
IQTVNNYDKEVFNGDIGKITRIDIEESLVYISIDDREVEYELGELDEIALAYAISVHKSQ
GSEYPAVVIPLATQHYTMLQKNLLYTGVTRGKKLVVIVGQPKALAIAVKRTHVTSRLTHL
SARLANG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttccacccagaagcctcgcctgagttcctcgccggcaccatagaacgggtt
acttttcatagcgaggaaaccggattctgcgtcctgcgaatcaaagtacgtggtgaacac
aatctcgtcaccgtagttggcaataccgctacggtcacgccgggggaatatgtggaatgt
cgcggtgagtggattaacgaccgcacccatggacttcagttcaaagcaaaacatctgaaa
gtcatcccccccagcaccctcgaagggattgaaaaatatctcggctcgggcatggtcagg
ggaatcggcccccacttcgccaagaaactggtgcaagccttcggtgagcaggttttcgaa
gttatcgaacatacagccgagcgcctcaccgaattagacggtatcggccccaagcgcaaa
gcgcgagtcatccagtcctgggcagaacaaaaagcggttcgcgctatcatggtgtttctg
caatcccagggcgtaggcagcgccagggcggttcgtatttataagacctatggcgatcac
gctatcgaacgggttcgcgaaaatccttaccggctggctctagatatccatggcatcggc
tttaaaaccgccgataggattgcccaacgactaggaatccccgccgattctctcatccgc
gcccaggcgggagtccgtcatgtactccaggaatttacgaccgaaggacactgcgcgatg
gagcaggacaagttagtggaaacagctagtaaattactggaaatccctgttcctactatc
gaacaagccattgctcaagaagtcaccgcagggcaactcatcgccgaagttattcatgac
aaatcctgcctctttcttactcccctttatcgctctgaaacgggggtcgccaaacatttg
caacgcctccttcagggtcgtcccccttggggagaaatcaatacggataaggcaatcccc
tgggcggaagagaaaacgggattgcgcctttctccctctcagcgcgcagcggttacacaa
gcagtcggcagcaaaatcattgtcattagcgggggaccgggggtcggtaaaaccactgtc
gtcaatagcattatccgaattgttcaggtcaagcaaatccagatacaccttggggcaccc
accgggcgggcagcaaaacggcttgccgaatcgaccggttttgaagccaaaacaatccac
cgtctgcttgaatttaatcctcatgccataggtttcaagcatcataggggtaaccccctc
catacggatcttgtcattattgatgaagtttccatggtcgacgtgggattgatgaatcag
ctactccaagccatccccagtcatgcggcgtgcatattgataggcgatagagatcagcta
ccttcggtagggccagggcaggtgctagcggatattattgcttccaaaaaaatcaccgct
gtccacctcaccgaggtttttcgccaagcagccagatccaaaatcgttgtcaatgcccat
cgaatcaatcaaggaaaaatgcccgagagaacccatgaagcagccccgctcagcgatttc
tattttattcccaccgagtctcccgaaaccatccaggataggctcctagaattagtaagc
acgcggattcctaaacgcttcggctttgaccccattcgcgatattcaagttcttaccccc
atgaaccgcggcagccttggagcacaggcgcttaatgcgcttctgcaacagcaactcaat
gcccaagccagccccaagatcaaccggttcggttggacctttgccctgggcgataagatc
attcagaccgtcaataattatgataaagaagtcttcaatggagatatcggcaaaataaca
agaatagatattgaggaaagtctcgtgtatatcagcatcgatgaccgagaggtagaatac
gagttaggcgagcttgacgaaattgctttggcctacgctatctcggtgcacaaaagccag
ggttccgaataccccgcagtcgtcattcccctagccacccagcactataccatgctacag
aaaaatctgctctacactggcgttacccggggcaaaaaactggttgtcattgtgggacag
cctaaagcgcttgccattgccgtcaaaaggactcatgtaacctcccgcctgacccacctt
tcagcgcggttagcaaacggttaa

DBGET integrated database retrieval system