KEGG   Nitrosococcus oceani: Noc_0999Help
Entry
Noc_0999          CDS       T00281                                 

Definition
NAD-dependent epimerase/dehydratase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
noc  Nitrosococcus oceani
Brite
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Noc_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1106497..1107486)
Genome map
AA seq 329 aa AA seqDB search
MTSFVTGATGFVGSAVVKQLLDAGETVRVLARSNSNRRNLEGLPVEIFEGDLKDQRRLEK
ALHGCQALFHVAADYRLWAPRSQDFYDTNVQGSQNIMHAAAEAGVNRIVYTSSVATLGLS
PDGTPAHEETPSSLETMIGHYKRSKFLAEESIKDLGHRLKLNIVIVNPSTPIGPRDIKPT
PTGRVIVMAASGGMPAYMNTGLNVVHVDDVAAGHLLAFEKGRIGERYILGGENLTLRDIL
EAIAQLTHRRPPRFRLSPHAVLPIAHLAQGWARLTSGKEPMTTVDGVRMAKKYMFFSSTK
AEQLLGYQSRPAQEAIHDAISWFQANDYL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctttgttaccggtgcaaccggcttcgtgggctcggcggtagtcaaacaacta
ctcgatgcgggagaaaccgtccgggtattagcccgctctaatagcaatcggcgtaatttg
gaagggctacccgtagaaatctttgaaggcgatctcaaggatcaacggcgcctagaaaaa
gcgctccatggctgccaagccctttttcatgtcgcggctgattaccgcttatgggccccc
cgttcgcaagacttttatgacactaatgtccagggctcccaaaatatcatgcacgctgcg
gcggaagccggcgttaaccgtattgtttacaccagtagcgtcgccacgctgggattaagc
cctgatggcacgccagcccatgaggagaccccttccagccttgaaaccatgatcggccac
tataaacgatctaaattcttggctgaggagtccatcaaggatctaggacaccggctgaag
ctgaatatcgtgattgtgaatccctccacccccattggaccgcgggatatcaaacccacg
cctaccggcagagtcattgtcatggccgcttcgggaggcatgcccgcctatatgaacact
ggcctcaacgtagtccatgtggatgatgtggccgccggccatctcctggcctttgaaaaa
ggccgcattggcgagcgttatatccttggaggagaaaatctcactctgcgcgatattcta
gaagcaatcgcccagcttacccaccgccgtccccccagattccggctttcccctcatgcg
gtcctgcctatcgcccatcttgcccaaggctgggcccgcctgaccagcggcaaagaaccc
atgaccactgtcgatggcgtgcggatggcaaagaaatatatgtttttttctagcactaag
gcggaacaactgctaggttatcaatcccgccccgcccaggaagcgattcatgatgcgatt
agctggtttcaggctaatgactatctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system