KEGG   Nitrosococcus oceani: Noc_1020Help
Entry
Noc_1020          CDS       T00281                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
noc  Nitrosococcus oceani
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Noc_1020
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_1020
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Noc_1020
Enzymes [BR:noc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Noc_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1130615..1131799
Genome map
AA seq 394 aa AA seqDB search
MPDEKGHFGPYGGRFVAETLMEPIEELRQAYARYRDDPDFQAELEADLAHYVGRPTPLYF
AKRWSEQLGGARIFLKREDLSHTGAHKINNTVGQALLAKRMGKTRLIAETGAGQHGVATA
TVAARLGLECVVYMGAEDIERQAPNVYRMRLLGAEVVPVTSGSRTLKDALNEAMRDWVTH
VDNTFYVIGTVAGPHPYPVMVRDFQAVIGREARTQILEQLGALPQALVACVGGGSNAIGL
FHSFCKDEQVALYGVEAAGLGLESGQHAASLCAGKPGVLHGNRTYLVENSHGQIIDTHSI
SAGLDYPGVGPEHAWLKDTGRATYVAISDEEALGAFHALTRIEGIIPALESSHALAYATQ
LAPTLAPEQGIIVNLSGRGDKDINTVAKIEGISL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgaaaagggtcattttggtccttatggtggccgctttgtagcggaaaccctg
atggagcctattgaggaactccgccaggcctatgcacgctaccgtgatgatccagatttc
caggccgagctagaagccgaccttgcccattatgtggggcggccgacgcccttgtatttt
gccaaacgctggagcgagcagttagggggtgcccggatctttttgaagcgggaagatcta
agtcataccggcgcccataaaatcaacaataccgtggggcaagccctgctggcaaagcgg
atggggaagactcgtttgatcgcggaaacgggagcgggtcagcatggcgtagctaccgcc
acggtagccgcccgtttagggttggaatgcgtggtctacatgggggctgaggatatagaa
cgacaagcccctaatgtttaccggatgcgcctgttaggggcagaagtagtgccggtgact
tccgggtctagaaccttgaaggatgccttgaatgaagccatgcgggattgggtgactcat
gtggataacaccttttatgtgattggcaccgtggcggggcctcatccctatcccgtgatg
gtgcgggatttccaggcggtgattgggcgggaggcccggacccagattctagagcagcta
ggcgcgcttccccaggctttggtggcttgcgtggggggagggtccaacgccatcggctta
tttcattctttttgcaaggatgagcaggtcgcactctatggtgtggaagcggcggggcta
ggattggagagcggacaacatgccgcttccctctgtgcgggcaaaccgggtgttcttcat
ggtaaccggacctatttggtggaaaatagccatggtcaaattatagacacccattccatt
tcagcgggtcttgattatcctggggtaggccccgagcatgcttggctgaaggatactggg
cgggcgacctatgtggcgattagcgatgaggaggccctgggggcttttcatgccttgacc
cgtattgaaggcattattcccgctttggaaagcagtcatgccttggcctacgctacgcaa
ttggcccccactttagctccagagcaggggattatcgtgaatctttcagggcgcggggat
aaagatatcaatacggtagccaaaattgaggggatttccctgtga

DBGET integrated database retrieval system