KEGG   Nitrosococcus oceani: Noc_1021Help
Entry
Noc_1021          CDS       T00281                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
noc  Nitrosococcus oceani
Pathway
noc00260  Glycine, serine and threonine metabolism
noc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01130  Biosynthesis of antibiotics
noc01230  Biosynthesis of amino acids
Module
noc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_1021
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Noc_1021
Enzymes [BR:noc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Noc_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABA57529
JGI: Noc1021
UniProt: Q3JCB7
Position
1131796..1132611
Genome map
AA seq 271 aa AA seqDB search
MSRITERFTVLRGQGRKALVPYITAGDPQPQVTVPLMHAMVAAGADILELGVPFSDPMAD
GPVIQKACERALAAGTSLLDVLAMVAEFRRKDQETPVILMGYLNPIEILGYRSFAEQAAA
HGVDGLLTVDMPPEEAEPLAAVCKEQGLDRIFLLAPTSSPKRIEQISALGSGFIYYVSLK
GVTGASTLDVDDVSQRVAKIRHYTTMPVGVGFGIRDARSAAQIASIADAAVVGSALVKRI
EQYQNRPEVIPEEVSALLRTMREAIDATENV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggattaccgagcgtttcaccgtacttcgggggcaaggccgaaaagccctagtt
ccttatattacggcgggcgatccccagccccaggttacggttcctttaatgcatgccatg
gtggcggcgggagctgatatcctagaattaggagtccctttttccgatccaatggccgat
ggcccggtcattcagaaggcctgcgagcgggcgctggcggcgggtacttccttactagat
gttttggcgatggtcgctgaatttcgccgtaaggatcaggaaaccccggtaattttaatg
ggttaccttaatcccattgaaatactaggctatcgaagttttgccgagcaagcggctgcc
cacggggttgatggccttctgacagtggatatgccgcccgaggaagcggagcctctggcc
gcagtctgcaaggagcaagggcttgatcgcatttttttgctggcgcccacgagctctccg
aagcgtatagagcaaattagtgccttgggcagtggatttatttactatgtttccttaaaa
ggagtgacgggcgcctctaccctcgatgtggacgatgttagtcaacgtgtggctaagatc
cggcactataccactatgccggtaggggtgggattcggtattcgggacgcgcgctcggcc
gctcagatcgcctctattgccgatgcggcggtcgtggggagcgctctagtcaaacgcatt
gagcaataccagaatcgccccgaggtgattccggaggaagtcagtgctttactacgaaca
atgcgcgaagctattgatgccactgaaaatgtttaa

DBGET integrated database retrieval system